Solenopsis invicta (red fire ant): 105203546 Help Entry 105203546         CDS       T03916                                  Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism soc  Solenopsis invicta (red fire ant) Pathway soc03008   Ribosome biogenesis in eukaryotes soc03013   Nucleocytoplasmic transport soc03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:soc00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     105203546    03008 Ribosome biogenesis in eukaryotes     105203546   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     105203546  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:soc03019]     105203546    03009 Ribosome biogenesis [BR:soc03009]     105203546    03016 Transfer RNA biogenesis [BR:soc03016]     105203546    03036 Chromosome and associated proteins [BR:soc03036]     105203546   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:soc04147]     105203546    04031 GTP-binding proteins [BR:soc04031]     105203546 Messenger RNA biogenesis [BR:soc03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      105203546 Ribosome biogenesis [BR:soc03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     105203546   Pre-60S particles     105203546 Transfer RNA biogenesis [BR:soc03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     105203546 Chromosome and associated proteins [BR:soc03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      105203546    Spindle formation proteins     105203546 Exosome [BR:soc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105203546 GTP-binding proteins [BR:soc04031]  Small (monomeric) G-proteins   Ran Family    Ran     105203546 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 RNA_helicase GTP_EFTU Gtr1_RagA AAA_24 ArgoMid AAA_16 AAA_7 Pox_A32 DUF5906 DUF5935 Motif Other DBs NCBI-GeneID:  105203546 NCBI-ProteinID:  XP_011170653 LinkDB All DBs Position 1:complement(7431371..7435409) Genome browser AA seq 215 aa AA seqDB search MANEPDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLIFHTNRGPIRF NVWDTAGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCG NKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPA LLPPEVTMDPQWQQQIEKDLKEAQETALPEDDEDL NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggcaaatgagcccgatatgcccactttcaaatgtgtgctagttggcgatggtggtact ggcaaaactacttttgtcaaacggcatctaaccggtgaatttgagaagaaatatgttgca actctgggagtcgaggttcatccgctgattttccataccaatcgtggaccgattcgcttc aatgtctgggacacagctggccaagagaagtttggtggccttcgtgacggctattacatt caaggacaatgcgccgttattatgtttgacgttacatccagggtaacgtacaaaaatgtg cccaattggcatagggatctggttcgcgtctgcgaaaacataccgattgttctttgcggt aataaagttgatataaaggacagaaaagttaaagccaagagtatcgtgtttcacagaaag aagaacctacagtactatgatatcagtgccaagagtaattacaactttgaaaaacctttc ttatggttggctcgcaagttgattggagatccaaatttagaattcgtcgctatgcctgca cttctgccaccggaggtcacaatggatccacaatggcagcaacaaatcgagaaagatctc aaggaagctcaagaaacggctttgccagaagacgacgaagatctttag

DBGET integrated database retrieval system