Spinacia oleracea (spinach): 110804025 Help Entry 110804025         CDS       T05137                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism soe  Spinacia oleracea (spinach) Pathway soe03420   Nucleotide excision repair soe04120   Ubiquitin mediated proteolysis soe04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:soe00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110804025    04120 Ubiquitin mediated proteolysis     110804025   09124 Replication and repair    03420 Nucleotide excision repair     110804025  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:soe04121]     110804025    03400 DNA repair and recombination proteins [BR:soe03400]     110804025 Enzymes [BR:soe01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      110804025 Ubiquitin system [BR:soe04121]  Ubiquitin ligases (E3)   UBL E3 ligases    110804025   Multi subunit type E3    SCF complex     Ring finger protein      110804025    Cul2 complex      110804025    Cul3 complex      110804025    Cul4 complex      110804025    Cul7 complex      110804025    Cul8 complex      110804025    Cul9 complex      110804025 DNA repair and recombination proteins [BR:soe03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       110804025     TCR (transcription coupled repair) factors      Cul4-CSA complex       110804025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  110804025 NCBI-ProteinID:  XP_021865274 UniProt:  A0A9R0JCB3 LinkDB All DBs Position 1:complement(131054991..131058626) Genome browser AA seq 114 aa AA seqDB search MDSDVVMVPAGEGSSTGAGPSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDLCI ECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggattccgacgtagttatggttcccgccggcgagggttctagcaccggagccggccct tcttctaagaaacctaagcgtttcgagatcaaaaaatggaacgctgtcgctctttgggct tgggatattgttgtcgacaattgtgcaatttgtcgtaatcatatcatggatctatgtatt gaatgccaagctaatcaagctagtgctacgagtgaggagtgcactgtcgcttggggtgtc tgcaaccatgccttccatttccattgcatcagccgttggttaaaaactcgacaagtatgc ccattagataatagtgagtgggagtttcagaaatatggacattag

DBGET integrated database retrieval system