Solanum tuberosum (potato): 102583049 Help Entry 102583049         CDS       T02981                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sot  Solanum tuberosum (potato) Pathway sot03420   Nucleotide excision repair sot04120   Ubiquitin mediated proteolysis sot04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sot00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102583049    04120 Ubiquitin mediated proteolysis     102583049   09124 Replication and repair    03420 Nucleotide excision repair     102583049  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sot04121]     102583049    03400 DNA repair and recombination proteins [BR:sot03400]     102583049 Enzymes [BR:sot01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      102583049 Ubiquitin system [BR:sot04121]  Ubiquitin ligases (E3)   UBL E3 ligases    102583049   Multi subunit type E3    SCF complex     Ring finger protein      102583049    Cul2 complex      102583049    Cul3 complex      102583049    Cul4 complex      102583049    Cul7 complex      102583049    Cul8 complex      102583049    Cul9 complex      102583049 DNA repair and recombination proteins [BR:sot03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       102583049     TCR (transcription coupled repair) factors      Cul4-CSA complex       102583049 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  102583049 NCBI-ProteinID:  XP_006345265 UniProt:  A0ABQ7W2S2 LinkDB All DBs Position Un AA seq 116 aa AA seqDB search MASPDTDVPMVPAGESSTGAGTSNKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcgtcaccggataccgatgtgccgatggttcccgccggcgagagttcaaccggagct ggaacgtctaacaaaaagccgaagcgatttgagatcaaaaagtggaacgctgtttctctc tgggcttgggatattgtggtagataattgtgccatctgtaggaatcacatcatggatctg tgtatcgagtgtcaagctaatcaagctagcgcaacaagtgaggaatgcacggttgcttgg ggtgtttgcaaccatgcattccacttccattgcattagtaggtggctcaagactcgtcaa gtgtgtccacttgataacagcgagtgggagtttcagaagtacggtcactag

DBGET integrated database retrieval system