Solanum tuberosum (potato): 102595356 Help Entry 102595356         CDS       T02981                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sot  Solanum tuberosum (potato) Pathway sot03420   Nucleotide excision repair sot04120   Ubiquitin mediated proteolysis sot04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sot00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102595356    04120 Ubiquitin mediated proteolysis     102595356   09124 Replication and repair    03420 Nucleotide excision repair     102595356  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sot04121]     102595356    03400 DNA repair and recombination proteins [BR:sot03400]     102595356 Enzymes [BR:sot01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      102595356 Ubiquitin system [BR:sot04121]  Ubiquitin ligases (E3)   UBL E3 ligases    102595356   Multi subunit type E3    SCF complex     Ring finger protein      102595356    Cul2 complex      102595356    Cul3 complex      102595356    Cul4 complex      102595356    Cul7 complex      102595356    Cul8 complex      102595356    Cul9 complex      102595356 DNA repair and recombination proteins [BR:sot03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       102595356     TCR (transcription coupled repair) factors      Cul4-CSA complex       102595356 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  102595356 NCBI-ProteinID:  XP_006357405 UniProt:  M1A184 LinkDB All DBs Position Un AA seq 120 aa AA seqDB search MSTDVEMDAADEGSTVTAPPAPCCSSSTKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNH IMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgtctacagacgtcgagatggatgccgccgatgaaggatccaccgttaccgcacctccg gctccatgctgttcttcttctacgaagaaacccaagcgttttgagatcaaaaagtggaac gctgtctctttatgggcttgggatattgttgtagacaactgtgctatttgcaggaaccat atcatggatctctgcattgaatgtcaagctaatcaagctagtgccactagcgaggagtgc actgttgcctggggtgtatgtaatcatgccttccactttcactgcatcagtcgatggctc aagacccgtcaagtgtgcccattagataacagtgagtgggagtttcagaagtatggtcac tag

DBGET integrated database retrieval system