Sphingobium sp. AntQ-1: sphantq_02809 Help Entry sphantq_02809     CDS       T10291                                  Symbol atpC_1 Name (GenBank) ATP synthase epsilon chain   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism spag  Sphingobium sp. AntQ-1 Pathway spag00190   Oxidative phosphorylation spag01100   Metabolic pathways Module spag_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:spag00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     sphantq_02809 (atpC_1)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:spag00194]     sphantq_02809 (atpC_1) Photosynthesis proteins [BR:spag00194]  Photosystem and electron transport system   F-type ATPase [OT]    sphantq_02809 (atpC_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  WCP14364 LinkDB All DBs Position 1:complement(2832992..2833246) Genome browser AA seq 84 aa AA seqDB search MALHFELVTPEKLVRSAEVWQVVVPGTDGDFGVLEGHAPFMSTVRDGSIQIFASAGAAPE IIPVEGGFAEVNEKGLTVLAEKAG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggcactgcatttcgaactcgtaaccccggaaaagctcgtccgctcggcggaagtctgg caggtcgtggtgcccggcaccgatggcgacttcggcgtgctggagggtcatgcgcccttc atgtcaacggtccgcgacggcagcatccagatatttgcgtcggccggcgccgcgccggaa atcatcccggtcgaaggcggctttgccgaagtgaatgaaaagggcctgacggtcctggca gaaaaggccggctga

DBGET integrated database retrieval system