Sphingobium sp. AntQ-1: sphantq_03089 Help Entry sphantq_03089     CDS       T10291                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism spag  Sphingobium sp. AntQ-1 Pathway spag01100   Metabolic pathways spag01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spag00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     sphantq_03089 (acpP_2)    00074 Mycolic acid biosynthesis     sphantq_03089 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     sphantq_03089 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  WCP14641 LinkDB All DBs Position 1:3086158..3086391 Genome browser AA seq 77 aa AA seqDB search MSETADRVKKIVVEHLGVEAEKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAIDYIDSKQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtgagaccgcggatcgcgtaaagaaaatcgtcgtcgagcatctgggcgttgaagcc gaaaaggtgaccgaggatgccagcttcatcgacgatctgggcgcggacagcctggatatc gtggaactggtgatggcgttcgaagaagaattcggcgtcgaaatccccgacgatgcggct gagaagattgcgaccgtcaaggacgcgatcgactatatcgacagcaagcagtaa

DBGET integrated database retrieval system