Saprolegnia parasitica: SPRG_11654 Help Entry SPRG_11654        CDS       T04137                                  Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism spar  Saprolegnia parasitica Pathway spar03420   Nucleotide excision repair spar04120   Ubiquitin mediated proteolysis spar04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:spar00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     SPRG_11654    04120 Ubiquitin mediated proteolysis     SPRG_11654   09124 Replication and repair    03420 Nucleotide excision repair     SPRG_11654  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:spar04121]     SPRG_11654    03400 DNA repair and recombination proteins [BR:spar03400]     SPRG_11654 Enzymes [BR:spar01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      SPRG_11654 Ubiquitin system [BR:spar04121]  Ubiquitin ligases (E3)   UBL E3 ligases    SPRG_11654   Multi subunit type E3    SCF complex     Ring finger protein      SPRG_11654    Cul2 complex      SPRG_11654    Cul3 complex      SPRG_11654    Cul4 complex      SPRG_11654    Cul7 complex      SPRG_11654    Cul8 complex      SPRG_11654    Cul9 complex      SPRG_11654 DNA repair and recombination proteins [BR:spar03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       SPRG_11654     TCR (transcription coupled repair) factors      Cul4-CSA complex       SPRG_11654 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-RING_11 zf-C3HC4_2 zf-RING_16 PHD_NSD Motif Other DBs NCBI-GeneID:  24133677 NCBI-ProteinID:  XP_012205991 UniProt:  A0A067C2H1 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MEEEKKAADVDEPKRFEIKKWNAVALWSWDIVVDNCAICRNHIMDLCIECQANQASATSE ECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGR NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggaagaagagaagaaggcggcggacgtggacgagccgaagcgctttgagatcaagaag tggaacgcggtcgcgctctggagctgggacatcgtcgtcgacaactgcgccatctgccgc aaccacatcatggacctttgcatcgagtgccaggccaaccaggcctcggcgacgagcgag gagtgcacggtcgcgtggggcgtgtgcaaccacgccttccacttccactgcattagccgc tggctcaagacgcgacaggtctgcccgctcgacaaccgcgagtgggagttccaaaagtac ggccggtaa

DBGET integrated database retrieval system