KEGG   Solanum pennellii: 107012948
Entry
107012948         CDS       T04130                                 
Name
(RefSeq) (-)-camphene/tricyclene synthase, chloroplastic-like
  KO
K21925  (-)-camphene/tricyclene/(4S)-limonene/myrcene synthase [EC:4.2.3.117 4.2.3.105 4.2.3.16 4.2.3.15]
Organism
spen  Solanum pennellii
Pathway
spen00902  Monoterpenoid biosynthesis
spen01100  Metabolic pathways
spen01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:spen00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    107012948
Enzymes [BR:spen01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.15  myrcene synthase
     107012948
    4.2.3.16  (4S)-limonene synthase
     107012948
    4.2.3.105  tricyclene synthase
     107012948
    4.2.3.117  (-)-camphene synthase
     107012948
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth DUF4618
Other DBs
NCBI-GeneID: 107012948
NCBI-ProteinID: XP_015068413
LinkDB
Position
1:104548543..104551329
AA seq 590 aa
MVSILSNIGMMMVTFKRPSLFTSLRRHSANNIITKHSHPISATRRSGNYKPTMWDFQFIQ
SLHNPYAGDRYMKRLNELKKEVKKMMMTVEGSHDEELEKLELIDNLERLGVSYHFKDEIT
QILKSIHEQKITSTDNSLYSTALKFRLLRQHSFHISQDILNDFKDDQGNFKQSLCEDTKG
LLQLYEASFLSTESETLESANTFATSHLKDYLHNLKGDDQENWRMELVRHALELPLHCKI
LRVETRWYIDIYDKIPNANPLLLELAKLDFNILQATHQQDLKNLSRWWNKSWLAEKLPFT
RDRIVESLLWIAGMMFEPQKNEYCRTMLTKVLAMVTVIDDIYDVYGTLDELEIFTDAVQR
MDVKAMDQLPDYMKTCYLALFNTTTEIVYEVLKEQGINVIIYLTKSWSDLCKSYLREARW
YHSGYKPSLEEYMENGWITIGAPVVLVHTLFLVTNPITKEALESLTNYPDIIRCSATIIR
LTDDLGTSSDEMERGDVPKSIQCYMNEKGVSEEDAREHINLLIKETWKLMNTALQKENSL
FSETFIACAVNGARTSHTIYQHGDGYGIQNSHTKNRIRQLFFDPITISIP
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggtttcaatattgagtaacatagggatgatgatggtcaccttcaagagaccatcatta
tttacctcactccgtcgtcactctgctaataatattattactaagcactcacatcctatt
tccgccacaaggcgttcagggaattacaagcctaccatgtgggattttcaatttattcaa
tccctgcacaatccttatgcgggagacaggtatatgaagcgtttaaacgaactaaagaaa
gaagtgaagaagatgatgatgacggttgagggatcacatgatgaagagttagagaagttg
gagttgattgataatttagagaggcttggagtgagttaccactttaaagatgaaattacg
caaatattgaagagtatacatgaacaaaaaattactagtacagataattcattatactct
acagccttgaaatttaggctcctcagacaacatagttttcatatctctcaagatatattg
aacgatttcaaggatgatcagggtaacttcaagcaaagtctttgtgaagatacaaaagga
ttattacaattatatgaagcttcatttctctctacagaatctgaaaccttggagtccgcc
aatacatttgcaacgtcacatctaaaggattatttgcacaatttaaagggtgatgatcaa
gagaattggagaatggaactagtgcgccatgccctagaacttcctttgcattgcaagata
ttgagagttgagacaagatggtacattgacatttatgataaaatcccaaatgctaatcct
cttctgctggagcttgctaaattggatttcaacattctgcaagcaacacatcaacaagat
ttaaaaaatctatcaaggtggtggaacaagtcatggcttgcagaaaaattgccatttaca
agggatagaattgtggagtctttattatggatcgcaggcatgatgtttgaacctcaaaag
aacgaatactgccgaacaatgttgacaaaggtccttgctatggttacagtaatagatgac
atttatgatgtttatggcactcttgatgaactggaaatctttactgatgctgttcaaaga
atggatgtaaaagcaatggatcaacttccagattatatgaaaacatgttaccttgcactc
ttcaacactaccactgaaattgtgtacgaagttctcaaagagcaagggatcaacgtcatt
atctaccttacgaaatcatggtcagatttgtgtaaatcgtacttacgagaagcaagatgg
taccacagtggatataaaccaagtcttgaagaatacatggaaaatggatggattacaatt
ggagcaccagtggtattagtacatacattgttccttgtcacaaatccaattaccaaagag
gccttggaatccttaaccaattatcctgacattattcgatgctctgctactattattcgt
ctcacagatgatttggggacatcctcggatgaaatggaaagaggtgacgttcccaagtca
attcaatgttacatgaatgagaagggtgtttcagaagaagatgcaagagaacacatcaat
ttgttgataaaggagacatggaaactgatgaacactgctcttcaaaaggagaattcctta
ttttctgaaacattcattgcatgtgcagtaaatggtgcaagaactagtcacacaatttac
cagcatggagatggctatgggattcaaaattctcacacaaaaaatcgtattcgtcaatta
tttttcgaccccattactatttcaattccataa

DBGET integrated database retrieval system