KEGG   Sphingomonas piscis: G7077_04775
Entry
G7077_04775       CDS       T07460                                 
Name
(GenBank) glucose 1-dehydrogenase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
spii  Sphingomonas piscis
Pathway
spii00061  Fatty acid biosynthesis
spii00780  Biotin metabolism
spii01100  Metabolic pathways
spii01110  Biosynthesis of secondary metabolites
spii01212  Fatty acid metabolism
spii01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:spii00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    G7077_04775
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    G7077_04775
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    G7077_04775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:spii01004]
    G7077_04775
Enzymes [BR:spii01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     G7077_04775
Lipid biosynthesis proteins [BR:spii01004]
 Fatty acid synthase
  Component type
   G7077_04775
SSDB
Motif
Pfam: adh_short_C2 adh_short KR SDR DUF1776 THF_DHG_CYH_C Epimerase
Other DBs
NCBI-ProteinID: QIK78315
UniProt: A0A6G7YNJ2
LinkDB
Position
complement(965981..966727)
AA seq 248 aa
MSKLSGKVAVVTGASKGIGAGIARALAAEGASVIVNYASSKEGADAVVGDIIGAGGKAVA
VKGDVSKEADAAGIVQSAIDHFGRLDVLVNNSGIYGWAKIEEVTAEDYRRQFDVNVLGPL
LTTKAASPHLSEGASVINISSTVTSLLPADSAVYSGTKGALDAITGVLANELAPRKIRVN
AILPGLTETDGTRASGFTGSEFEQSIVAQTPLGRTGQPDDIAAVAVFLASDDARWVTGER
LIVSGGLR
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtcgaaattgtcaggcaaagtcgctgtcgtcactggcgcatcgaaaggtataggcgcc
ggtatcgccagggcgcttgctgcagagggcgcgtccgtcatcgtcaactacgcgtccagc
aaggaaggcgcggacgccgtcgtcggcgatatcatcggggctggcggcaaggccgtcgca
gtgaagggcgacgtttccaaggaagccgatgccgccgggatcgtccagtcggccatcgat
catttcggtcgcctagatgtgctggtcaacaacagcggcatctacggttgggccaagatc
gaggaggtgaccgcggaagattaccgccgccagttcgacgtcaacgtgctcgggccgctt
ctcaccacgaaggcggcgtcgccgcacctttccgagggtgctagtgtgatcaacatctcg
tcaaccgtgaccagcctgctgccggccgactcggcggtgtacagcggcactaaaggggcg
ctcgacgccatcaccggcgtgctcgccaatgagcttgccccacgcaagatccgcgtcaac
gccatcctgcccggccttacggaaaccgacggcacccgagcctcgggtttcaccgggtcg
gagttcgagcagagcatcgtcgcccagacaccgctcggcagaaccggccagccggacgat
attgcggcggttgcagtgtttcttgcttccgacgacgcccgctgggtgacgggtgagagg
ctgatcgtgagtggcggcctgcgctga

DBGET integrated database retrieval system