Sphingomonas piscis: G7077_04775
Help
Entry
G7077_04775 CDS
T07460
Name
(GenBank) glucose 1-dehydrogenase
KO
K00059
3-oxoacyl-[acyl-carrier protein] reductase [EC:
1.1.1.100
]
Organism
spii
Sphingomonas piscis
Pathway
spii00061
Fatty acid biosynthesis
spii00780
Biotin metabolism
spii01100
Metabolic pathways
spii01110
Biosynthesis of secondary metabolites
spii01212
Fatty acid metabolism
spii01240
Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:
spii00001
]
09100 Metabolism
09103 Lipid metabolism
00061 Fatty acid biosynthesis
G7077_04775
09108 Metabolism of cofactors and vitamins
00780 Biotin metabolism
G7077_04775
09110 Biosynthesis of other secondary metabolites
00333 Prodigiosin biosynthesis
G7077_04775
09180 Brite Hierarchies
09181 Protein families: metabolism
01004 Lipid biosynthesis proteins [BR:
spii01004
]
G7077_04775
Enzymes [BR:
spii01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.1 With NAD+ or NADP+ as acceptor
1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase
G7077_04775
Lipid biosynthesis proteins [BR:
spii01004
]
Fatty acid synthase
Component type
G7077_04775
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short_C2
adh_short
KR
SDR
DUF1776
THF_DHG_CYH_C
Epimerase
Motif
Other DBs
NCBI-ProteinID:
QIK78315
UniProt:
A0A6G7YNJ2
LinkDB
All DBs
Position
complement(965981..966727)
Genome browser
AA seq
248 aa
AA seq
DB search
MSKLSGKVAVVTGASKGIGAGIARALAAEGASVIVNYASSKEGADAVVGDIIGAGGKAVA
VKGDVSKEADAAGIVQSAIDHFGRLDVLVNNSGIYGWAKIEEVTAEDYRRQFDVNVLGPL
LTTKAASPHLSEGASVINISSTVTSLLPADSAVYSGTKGALDAITGVLANELAPRKIRVN
AILPGLTETDGTRASGFTGSEFEQSIVAQTPLGRTGQPDDIAAVAVFLASDDARWVTGER
LIVSGGLR
NT seq
747 nt
NT seq
+upstream
nt +downstream
nt
atgtcgaaattgtcaggcaaagtcgctgtcgtcactggcgcatcgaaaggtataggcgcc
ggtatcgccagggcgcttgctgcagagggcgcgtccgtcatcgtcaactacgcgtccagc
aaggaaggcgcggacgccgtcgtcggcgatatcatcggggctggcggcaaggccgtcgca
gtgaagggcgacgtttccaaggaagccgatgccgccgggatcgtccagtcggccatcgat
catttcggtcgcctagatgtgctggtcaacaacagcggcatctacggttgggccaagatc
gaggaggtgaccgcggaagattaccgccgccagttcgacgtcaacgtgctcgggccgctt
ctcaccacgaaggcggcgtcgccgcacctttccgagggtgctagtgtgatcaacatctcg
tcaaccgtgaccagcctgctgccggccgactcggcggtgtacagcggcactaaaggggcg
ctcgacgccatcaccggcgtgctcgccaatgagcttgccccacgcaagatccgcgtcaac
gccatcctgcccggccttacggaaaccgacggcacccgagcctcgggtttcaccgggtcg
gagttcgagcagagcatcgtcgcccagacaccgctcggcagaaccggccagccggacgat
attgcggcggttgcagtgtttcttgcttccgacgacgcccgctgggtgacgggtgagagg
ctgatcgtgagtggcggcctgcgctga
DBGET
integrated database retrieval system