Sardina pilchardus (sardine): 134070935 Help Entry 134070935         CDS       T10667                                  Symbol rap1b Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism spil  Sardina pilchardus (sardine) Pathway spil04010   MAPK signaling pathway spil04510   Focal adhesion spil04517   IgSF CAM signaling spil04520   Adherens junction Brite KEGG Orthology (KO) [BR:spil00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     134070935 (rap1b)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     134070935 (rap1b)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     134070935 (rap1b)    04520 Adherens junction     134070935 (rap1b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:spil04147]     134070935 (rap1b)    04031 GTP-binding proteins [BR:spil04031]     134070935 (rap1b) Exosome [BR:spil04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    134070935 (rap1b)   Exosomal proteins of other body fluids (saliva and urine)    134070935 (rap1b)   Exosomal proteins of colorectal cancer cells    134070935 (rap1b) GTP-binding proteins [BR:spil04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     134070935 (rap1b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  134070935 NCBI-ProteinID:  XP_062383454 LinkDB All DBs Position 23:15546767..15603690 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNSCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSN CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgaatacaagttagtagtccttggctcaggaggcgtgggcaagtctgctttgacg gtgcagttcgttcaaggcatcttcgtggagaagtatgaccccacaatagaagactcgtac agaaagcaagtggaggtggatgggcagcagtgcatgctcgagatcctggacactgcaggg acggaacaattcacagccatgagggatctgtacatgaagaatgggcagggctttgcgcta gtatactccataacagcacagtctacgttcaacgacctgcaggacctcagagaacagatc ttacgagtcaaagacaccgacgatgtgccgatgatcttggtggggaacaagtgtgacctg gaggacgagcgcgtggtggggaaggagcagggacagaacctggcccgccagtggaacagc tgcgccttcctcgagtcctccgccaagtccaagattaacgtcaacgagatcttctatgac ctggttcggcaaatcaacaggaaaaccccagtgcccgggaaggcgcgcaaaaagtccaac tgccagttgctctaa

DBGET integrated database retrieval system