Shewanella pealeana: Spea_0965 Help Entry Spea_0965         CDS       T00606                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism spl  Shewanella pealeana Pathway spl00790   Folate biosynthesis spl01100   Metabolic pathways spl01240   Biosynthesis of cofactors Module spl_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:spl00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Spea_0965 Enzymes [BR:spl01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Spea_0965  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Spea_0965  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Spea_0965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ABV86292 UniProt:  A8H155 LinkDB All DBs Position 1176911..1177264 Genome browser AA seq 117 aa AA seqDB search MDKVLIRELRIETVIGIYEWEKQIHQSLLIDLDMAWNNRPAADSDDYQFALCYETVSNRL TALITEKPIELIETVAEMVANCVMTEFNVPWVKVKVMKPGAIPSAAAVGVEIERGYA NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggataaagtactgattagagaacttagaattgaaaccgttattgggatctatgagtgg gaaaaacagatccaccaaagcttacttatcgatttagatatggcttggaataatcgccca gcagccgatagcgatgattatcaatttgcactgtgttatgaaacggtatcgaatcgatta acggcattgatcactgaaaagccgatcgagctgattgaaaccgtggctgagatggtggcc aattgtgtgatgactgaattcaacgtgccttgggttaaggtcaaggtgatgaagcccggt gccataccgtcagccgctgccgtgggtgttgagattgaaagaggttatgcgtag

DBGET integrated database retrieval system