Shewanella pealeana: Spea_2148
Help
Entry
Spea_2148 CDS
T00606
Name
(GenBank) short-chain dehydrogenase/reductase SDR
KO
K00059
3-oxoacyl-[acyl-carrier protein] reductase [EC:
1.1.1.100
]
Organism
spl
Shewanella pealeana
Pathway
spl00061
Fatty acid biosynthesis
spl00780
Biotin metabolism
spl01100
Metabolic pathways
spl01110
Biosynthesis of secondary metabolites
spl01212
Fatty acid metabolism
spl01240
Biosynthesis of cofactors
Module
spl_M00083
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:
spl00001
]
09100 Metabolism
09103 Lipid metabolism
00061 Fatty acid biosynthesis
Spea_2148
09108 Metabolism of cofactors and vitamins
00780 Biotin metabolism
Spea_2148
09110 Biosynthesis of other secondary metabolites
00333 Prodigiosin biosynthesis
Spea_2148
09180 Brite Hierarchies
09181 Protein families: metabolism
01004 Lipid biosynthesis proteins [BR:
spl01004
]
Spea_2148
Enzymes [BR:
spl01000
]
1. Oxidoreductases
1.1 Acting on the CH-OH group of donors
1.1.1 With NAD+ or NADP+ as acceptor
1.1.1.100 3-oxoacyl-[acyl-carrier-protein] reductase
Spea_2148
Lipid biosynthesis proteins [BR:
spl01004
]
Fatty acid synthase
Component type
Spea_2148
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short_C2
adh_short
KR
Epimerase
SDR
3HCDH_N
Polysacc_synt_2
RmlD_sub_bind
NAD_binding_2
UDPG_MGDP_dh_N
Methyltransf_11
TPMT
NmrA
ADH_zinc_N
Methyltransf_25
Methyltransf_23
YcaO
Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID:
ABV87468
UniProt:
A8H4I1
LinkDB
All DBs
Position
2601739..2602482
Genome browser
AA seq
247 aa
AA seq
DB search
MKHKDKVIFVTGAGQGMGLAMVKLFAEQGAKVAAIDINEAAAKKVAEQQSAESGTEVIGI
GCDISQSSSVRDAITEVVQRLGSIDVVINNAGIGSIDSFIDTPDENWHKVINVNLTGTFY
CCREAARVMKEQGSGCIINISSTAVMSGDGPSHYCASKAGVIGLTRSIAKELAASGIRVN
TIVPGPTNTPMMADIPEEWTQQMIDAIPLGRMGEPADIAKLASFIASDDASFITGQNLAV
NGGMAFL
NT seq
744 nt
NT seq
+upstream
nt +downstream
nt
atgaaacataaagataaagttatttttgttaccggtgcgggtcaaggaatgggactggca
atggttaagttatttgccgagcaaggcgctaaagtcgccgctatcgatattaatgaagct
gcagctaaaaaagtggctgagcaacaaagtgctgagtcaggcactgaggttattggtatt
ggttgcgatatttcccagtccagttcagtccgagacgcgattacggaggtggtgcaacgc
ctcggcagtattgatgttgtgatcaataacgcggggatcggctcaattgactcatttatc
gataccccggacgaaaactggcacaaagtgattaatgtcaatcttaccggcaccttctac
tgttgccgcgaagctgcccgtgtcatgaaagagcagggtagcggttgtatcatcaatatt
tcgagcaccgcagtgatgtcaggtgatggccctagtcattactgtgcatctaaagcgggc
gttatcggacttacccgctcaattgcaaaagagcttgctgcaagtggcattcgcgttaat
accatagtccccggtcctaccaataccccaatgatggctgatattccagaagagtggact
cagcagatgatcgacgccattccattaggtcgtatgggagaacccgctgatattgccaag
cttgcatcttttattgccagtgacgatgcctcttttataaccgggcagaacttagcggta
aacggcggaatggcgtttttataa
DBGET
integrated database retrieval system