KEGG   Streptomyces platensis: CP981_00370
Entry
CP981_00370       CDS       T07341                                 
Name
(GenBank) aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
  KO
K21585  3-aminobutanoyl-CoA transaminase [EC:2.6.1.111]
Organism
spla  Streptomyces platensis
Brite
KEGG Orthology (KO) [BR:spla00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CP981_00370
Enzymes [BR:spla01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.111  3-aminobutanoyl-CoA transaminase
     CP981_00370
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2 DUF72
Other DBs
NCBI-ProteinID: QEV56528
LinkDB
Position
complement(84176..85381)
AA seq 401 aa
MDALAAKRKNVIASDQMIEGEYPIFVDRTSGAYFWDVDGNRYLDFFLSYGTVVLGHADRD
VDDQVIAEIRKGFATGLSKPVQTELVSELLEVIPGAEMAMLMKTGSDATGAAVRLSRSFT
GRDRVARFGYNGWHDWCAQWDHGIPRATRDLVHTFAYNDLDSLRALFERHPGEIACVVMM
PFEVEPPAPGFLEGVRELTRAHGALLVLDEMRSGFRMALGGAQEYFGVTADLATFSKAFA
NGYAISALTGRAEVLRRLDRVHISSTFYANSDAMAAALATLRKLRSGPHLERIHTLGSRL
QDGLRELTDKYAAPVEVVGHPPMPFLDFRLGSEEENQAAKRSFYTETIRAGVFFHPNHHW
FVCAATTEEDIDTAIEAARGGFEALVRDGYTGAVRSGEAAR
NT seq 1206 nt   +upstreamnt  +downstreamnt
atcgatgcgctggccgccaagcgaaagaatgtcatcgcctccgaccagatgatcgagggg
gagtaccccatattcgtcgaccggaccagcggcgcatacttctgggacgttgacggaaac
cgctatctcgattttttcctgtcgtatgggaccgtcgtactgggtcatgccgaccgggat
gtcgacgaccaggtcatcgccgagatccggaaaggattcgccaccgggctgagcaagccc
gtgcagaccgaactcgtcagcgaactcctcgaggtgatcccgggcgccgaaatggcgatg
ctgatgaagaccggatccgacgccaccggcgccgcggtgcgcctgtcgcgctccttcacc
ggccgtgaccgcgtcgcccgcttcggctacaacggctggcacgactggtgcgcccagtgg
gaccacggcatcccccgtgccacccgcgacctcgtgcacaccttcgcctacaacgacctc
gactccttgcgcgcgctgttcgagcggcacccgggcgagatcgcctgcgtcgtcatgatg
cccttcgaggtggagccgccggcccccggcttcctcgaaggcgtacgggagctgacgcgg
gcgcacggggccctgctggtcctggacgagatgcgttcgggcttccggatggccctcggc
ggcgcccaggagtatttcggtgtcaccgcggacctggcgaccttcagcaaggcgttcgcc
aacggctatgcgatctccgcactgaccggccgcgcggaggtgctgcgccgcctggaccgc
gtacacatctcctcgaccttctacgccaactccgacgccatggccgccgcactggcgacc
ctgcgcaagttgcgctcggggccgcacctggagcgcatccataccctgggcagccggctc
caggacgggctgcgcgagctcaccgacaagtacgccgcgccggtcgaggtggtcggccat
ccgcccatgcccttcctcgacttccggctcggcagcgaggaggagaatcaggcggccaag
cggtccttctacaccgagaccatccgggccggggtcttcttccaccccaaccaccactgg
ttcgtgtgcgccgccaccacagaggaggacatcgacaccgcgatcgaggcggcgcgcggc
gggttcgaggcgctggtacgggacggctataccggtgccgtccgctccggggaggccgcg
cgatga

DBGET integrated database retrieval system