Shewanella polaris: FH971_04175 Help Entry FH971_04175       CDS       T06579                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism spol  Shewanella polaris Pathway spol00670   One carbon pool by folate spol00790   Folate biosynthesis spol01100   Metabolic pathways spol01240   Biosynthesis of cofactors spol04981   Folate transport and metabolism Module spol_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:spol00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     FH971_04175 (folA)    00670 One carbon pool by folate     FH971_04175 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     FH971_04175 (folA) Enzymes [BR:spol01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      FH971_04175 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  QDE30234 UniProt:  A0A4Y5YC22 LinkDB All DBs Position 958961..959443 Genome browser AA seq 160 aa AA seqDB search MRIAMIAAMANNRVIGKDNKMPWHLPEDLRHFKAVTLSKPIVMGRKTFESIGRPLPGRLN IVISRNTEFSPEGVTCVTNYEDAIAAAGECEELVIIGGGQLYAQLLPKTDVLYLTLIDLD ADGDTFFPDWDDGSWDLQSSVNATNDKGLQYSFNTLVKKC NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgcgtatcgcaatgattgccgcaatggccaataacagagtcattggtaaagacaataaa atgccatggcatttacctgaagatcttcgtcatttcaaagctgtcaccttgtctaaacct attgtaatgggtcgaaaaacatttgaatccatcggacgaccattacctggaagactcaat atagtgataagtcgtaatactgagtttagtcctgaaggagtaacttgtgtaacaaattat gaagatgcaatcgctgccgcaggagagtgtgaagagttagttattattggtggtggccaa ctttatgcgcaattattgcctaaaaccgacgttttatacctaactttgattgatttagac gctgacggtgacactttctttcccgattgggatgatggttcttgggatttacagagctca gtaaatgcaacaaatgataaagggttgcaatatagctttaacactttagttaaaaagtgt taa

DBGET integrated database retrieval system