Sporosarcina sp. Te-1: J3U78_15910 Help Entry J3U78_15910       CDS       T08181                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism spoo  Sporosarcina sp. Te-1 Pathway spoo00790   Folate biosynthesis spoo01100   Metabolic pathways spoo01240   Biosynthesis of cofactors Module spoo_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:spoo00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     J3U78_15910 (folB) Enzymes [BR:spoo01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      J3U78_15910 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      J3U78_15910 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      J3U78_15910 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB TetR_C_5-like Motif Other DBs NCBI-ProteinID:  QTD40273 UniProt:  A0A975CAW9 LinkDB All DBs Position 3081446..3081814 Genome browser AA seq 122 aa AA seqDB search MDYIHLHEMEFYGYHGALPEENRLGQRFRATVSLAVDLQEAGRNDDLSKTVNYAEVYELC KSVVEGQPFQLIEAVAEEIATQVLRAFMDKVTGVRVVLVKPDPPIPGHYAAVSVDITRGR FE NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggattatattcatttacatgagatggaattttacgggtatcacggtgcgcttcctgaa gaaaaccggctaggccagcgctttcgggctaccgtctcattggcggttgatttgcaagag gccggccggaacgatgatctaagcaaaacggtgaattacgcggaagtatacgaattgtgc aagtcggtcgtggaagggcagccttttcagttgatcgaagcggtcgcggaagagattgca acgcaagtattacgcgctttcatggataaagtgacaggcgtccgggttgttctcgtgaag ccagatcccccgattccgggtcactacgcagctgtttccgttgatatcacaagggggcgt tttgaatga

DBGET integrated database retrieval system