KEGG   Streptococcus pyogenes M1 476 (serotype M1): M1GAS476_0178
Entry
M1GAS476_0178     CDS       T02499                                 
Symbol
nga
Name
(GenBank) NAD glycohydrolase
  KO
K18153  NAD+ glycohydrolase [EC:3.2.2.5]
Organism
spym  Streptococcus pyogenes M1 476 (serotype M1)
Pathway
spym00760  Nicotinate and nicotinamide metabolism
spym01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spym00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    M1GAS476_0178 (nga)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:spym00537]
    M1GAS476_0178 (nga)
Enzymes [BR:spym01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.5  NAD+ glycohydrolase
     M1GAS476_0178 (nga)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:spym00537]
 Enzymes
  M1GAS476_0178 (nga)
SSDB
Motif
Pfam: NADase_NGA DUF2683
Other DBs
NCBI-ProteinID: BAM29519
LinkDB
Position
1:144182..145546
AA seq 454 aa
MVYMRNKKVTLAHIVAKTSVAIALAGAMGSSLLANSTTYAVSGKENKKSDVKYETTKVME
ANATSSKEDNHVMHTLDGSMSTVWEENSPGGGVGEVLSYKFVSPMRIGRILIVNGDTSSK
ENYYKKNRIAKADVKYYNGNKLVLFQKIELGDTYTKKPHHIEIDKKLDVDRIDIEVTEVH
QGQNKDILALSEVTFGNMERDLFEKKFKEIKDKWVTDKQADEFIETADKYADKAVQMSAV
ASRAEYYRMYVSRKYHYKKEFVEKLKQVYKESGASHVTSKKDLMLAFDDAKRKSTIGRQE
NGLFVTSFAEDMALLFTDQGKLKSADQIENIKGVDSGKYSDGVYQYEYDSELTKNIDKLG
YIRTASGDTPGANSLNIPGCQTWSGKHIENSESELIFPSISVKDLKSKAVLAEIDAKGYF
EIIDPTIIAPNGDHKKVTGRFKIKKMQDRMQDRK
NT seq 1365 nt   +upstreamnt  +downstreamnt
gtggtttacatgagaaacaaaaaagtaacattagctcatattgtcgcaaagacaagtgtt
gctattgctttggctggagcaatgggtagcagtttattagctaatagcacaacgtacgct
gttagtggcaaagaaaataaaaaaagcgatgtcaaatatgaaacgaccaaagttatggaa
gctaacgcaacttcctctaaagaagacaatcatgtcatgcacacattagacggctcaatg
agtactgtctgggaggaaaattcacctggtggtggcgttggtgaggtactttcctacaag
tttgtttccccgatgcgtattgggagaattttaattgtgaatggagatacatctagcaag
gagaattactacaagaaaaatagaattgcaaaggctgatgttaaatactataacgggaat
aaattggtcctctttcaaaaaattgaattaggcgacacctacactaaaaaaccgcatcac
attgagattgataaaaaattagatgttgatcgtattgatattgaggtaacagaggtccat
cagggacaaaacaaggatattttagccttgtcagaggtcacttttggcaatatggaacgc
gatctttttgaaaaaaagtttaaagaaattaaagataaatgggtaacagataaacaagca
gatgagtttattgaaactgccgacaagtatgctgataaagctgttcagatgtctgctgtt
gcgtcacgtgctgagtattaccggatgtacgttagccgcaaataccactacaaaaaagag
tttgttgaaaaactaaaacaagtctacaaagaaagcggagcttctcacgttacaagtaaa
aaagatttgatgttagcttttgatgatgctaaaagaaagtcaacgattggtcgacaagaa
aacggtctttttgtgacaagttttgctgaagatatggcattgctctttactgatcaaggt
aagttaaaatcagctgaccaaattgaaaatataaaaggtgtcgatagcggaaaatatagc
gatggagtttatcaatatgagtacgattctgaactaacaaaaaacattgataagctaggc
tatatccgaacagctagcggagatacccctggagcaaattcgctcaacattcctggttgc
caaacgtggtcaggaaaacacattgaaaattcagaaagtgagttaattttcccatcgatt
agtgttaaagatctaaaatctaaagctgtcttagcagagattgatgccaaaggctatttt
gaaattattgatcctaccatcattgctccaaatggtgaccataaaaaagtaactggtcgc
ttcaaaattaagaaaatgcaagatagaatgcaagataggaagtaa

DBGET integrated database retrieval system