KEGG   Sphingomonas radiodurans: LLW23_12205
Entry
LLW23_12205       CDS       T08717                                 
Symbol
acsF
Name
(GenBank) magnesium-protoporphyrin IX monomethyl ester (oxidative) cyclase
  KO
K04035  magnesium-protoporphyrin IX monomethyl ester (oxidative) cyclase [EC:1.14.13.81]
Organism
srad  Sphingomonas radiodurans
Pathway
srad00860  Porphyrin metabolism
srad01100  Metabolic pathways
srad01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:srad00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin metabolism
    LLW23_12205 (acsF)
Enzymes [BR:srad01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.81  magnesium-protoporphyrin IX monomethyl ester (oxidative) cyclase
     LLW23_12205 (acsF)
SSDB
Motif
Pfam: Rubrerythrin DUF3231 Ferritin_2 DUF2383
Other DBs
NCBI-ProteinID: WBH15582
LinkDB
Position
complement(2619625..2620677)
AA seq 350 aa
MNAFSKIDPMAIAREDTVLSPRFYTTDFAAMDRIDVSPVRHEWDALIGEMVDDPNRLHFK
RTEAFDGVIESLPDGLREEFTDFLVSSLTAEFSGCILYAEIAKRVKNPDIKQLFKLMSRD
ESRHAGFINDTLKDAGIGIDLGFLTRTKKYTYFRPKFIFYATYLSEKIGYARYITIFRHL
ARHPELRFHPIFNWFELWCNDEFRHGDAFAILMRTDPKLLTGINKLWIRFFLVAVYATMY
VRDHNRPAFHKALGIDPTEYDRRVFTICSEITRQVFPVVLDTDSPRFARGLERMRGIAGA
IDTATKQGGIVGGIKRVGLMGAAAVAFARLYLTPVKRNEAPATVRMVPAW
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgaacgccttcagcaagatcgatccgatggcgatcgcgcgcgaagacacggtgctatcg
ccgcgcttctacacgaccgatttcgccgcgatggaccggatcgacgtgtcgccggtgcgc
cacgaatgggacgcgctgatcggcgaaatggtggacgatcctaaccggctccacttcaag
cggacggaagcgttcgacggcgtgattgagagcctgcccgatggcctgcgcgaggaattc
accgacttcctcgtcagctcgttgacggcggaattctcgggctgcatcctctacgccgag
atcgccaagcgggtgaagaaccccgatatcaagcaattgttcaagctgatgagccgcgac
gagagccgtcacgccggcttcatcaacgatacgctgaaggatgccgggatcgggatcgac
ctgggctttctgacgcggaccaagaaatacacgtacttccggccgaagttcatcttctac
gcgacctatctgagcgagaagatcggctatgcgcgctacatcacgatcttccgccatctg
gcgcggcacccggaacttcgcttccacccgatcttcaactggttcgaactgtggtgcaac
gacgagttccggcacggtgacgccttcgcgatcctgatgcgcaccgatcccaagctgctg
accggcatcaacaaattgtggatccgcttcttcctcgtggcggtgtacgcgacgatgtac
gtgcgcgatcacaaccggcctgcgtttcacaaggcgctcggcatcgatccgaccgaatat
gatcggcgcgtgttcacgatctgctcggagatcacgcgtcaggtgttcccggtggtgctc
gacaccgacagcccccgcttcgcgcgcggactggagcggatgcggggtatcgcaggggcg
atcgacaccgcaacgaagcaaggcgggatcgttggcggcatcaaacgtgtcggccttatg
ggggcggcagcagtcgccttcgcgcggctctacctgacgccggtgaagcgcaacgaagcg
cccgccaccgtccggatggtcccggcctggtga

DBGET integrated database retrieval system