Serratia plymuthica 4Rx13: SOD_c41020 Help Entry SOD_c41020        CDS       T02710                                  Symbol folB Name (GenBank) dihydroneopterin aldolase FolB   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism srl  Serratia plymuthica 4Rx13 Pathway srl00790   Folate biosynthesis srl01100   Metabolic pathways srl01240   Biosynthesis of cofactors Module srl_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:srl00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     SOD_c41020 (folB) Enzymes [BR:srl01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      SOD_c41020 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      SOD_c41020 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      SOD_c41020 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AGO57052 LinkDB All DBs Position complement(4637064..4637423) Genome browser AA seq 119 aa AA seqDB search MDIVFIEELTVITTIGVYDWEQNIRQKLVFDIEMGWDNRQAAASDDVNDCLSYADISEAI IQHVEPNRFALVERVAEEISEILLQRFNSSWVRIKVSKPGAVAHASRVGVIIERGTRPV NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatatcgtatttattgaagagcttaccgttattactaccattggcgtttatgattgg gaacaaaacattcgccagaagctggtgttcgatatcgaaatgggctgggacaaccgccag gccgctgccagcgatgatgtgaacgactgcctgagctatgccgatatcagcgaagccatc atccagcacgtggagccgaatcgttttgcgttagtggagcgggtggcagaggaaatatct gaaattttactccagcgcttcaattcctcgtgggtccgtattaaggtcagcaaaccgggc gcagttgcacacgccagccgggttggggtcattattgaacgtggtacccggccggtgtga

DBGET integrated database retrieval system