KEGG   Salinigranum rubrum: C2R22_21540
Entry
C2R22_21540       CDS       T05289                                 

Name
(GenBank) malate synthase
  KO
K19282  bifunctional (S)-malyl-CoA lyase/thioesterase [EC:4.1.3.24 3.1.2.30]
Organism
srub  Salinigranum rubrum
Pathway
srub00630  Glyoxylate and dicarboxylate metabolism
srub01100  Metabolic pathways
srub01120  Microbial metabolism in diverse environments
srub01200  Carbon metabolism
Module
srub_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:srub00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    C2R22_21540
Enzymes [BR:srub01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.30  (3S)-malyl-CoA thioesterase
     C2R22_21540
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     C2R22_21540
SSDB
Motif
Pfam: HpcH_HpaI
Other DBs
NCBI-ProteinID: AUV84161
UniProt: A0A2I8VQG2
LinkDB
Position
unnamed1:complement(124730..126034)
AA seq 434 aa
MSVKRHYEREFVRTFFTSPTAVKGEDDSAKMIRSASQLSGMSAPDVWVPDNEDATAPSMR
DEGVQNIVDVVSENGADFPGEIHPRMVWHRESPATRYQGFQHMLEIADPEKGAIQHIDGF
VIPEVGDIDDWKKADEFFTIVENEYGLEEGSLSMSVIVESGEAELAMGDLREEMGKPSNN
LERLFLLVDGEVDYTKDMRAMTPTGELPAWPELRHNTSRGASAAGLIAVDGPYDDIRDVE
GYHERMRDNQAKGMLGIWSLTPGQVVEANTAPLPPKTGSWLLEVDNRSVELVEEDGRQVY
DGDDVSLEETGDGYTLRVGSDEDELDDDELRETLLDMTAYVPSMDDIVDSMEEFEAAKEA
GKGAIAMTQSTTIVIDGIEVEIRKDRMWDEATYQAAQTPITLFQDVYEHRPDQHNELAEM
YGSDVVERATDVGN
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgagcgttaaacggcactacgaacgagagttcgtcagaacgttcttcacctcgccgacg
gcggtcaagggcgaagacgactccgcgaagatgatccgaagcgcgtcgcaactcagcggg
atgagcgcgcccgacgtctgggttccagacaacgaggacgcaacggcaccatcgatgcgt
gatgagggtgtccagaacatcgtcgacgtcgtctcggagaacggcgcggacttccccggt
gagattcacccgcggatggtgtggcaccgcgagtcgccggcgactcgctatcagggcttt
cagcacatgctggagatagccgacccggagaagggagcgatccaacacatcgacggcttc
gtcatccccgaagtcggcgacatcgacgactggaagaaggccgacgagttcttcaccatc
gtcgagaacgaatacggtctcgaagaaggcagtctctcgatgtcagtcatcgtcgagagc
ggggaagccgagttggcgatgggcgacctccgcgaggagatgggcaagccctcgaacaac
ctcgaacgcctgttcctcctcgtcgacggcgaagtcgactacacgaaggacatgcgcgcg
atgacgccgaccggtgaactcccggcgtggccggaactccgccacaacacctcgcgaggc
gcgagtgcggccggtctcatcgccgtcgacggtccctacgacgacatccgcgacgtcgaa
ggctaccacgaacggatgcgggacaaccaagccaaggggatgctcggcatctggtcgctc
acgcccggtcaggtggtcgaagccaacacggcaccgctcccgccgaagacggggagttgg
ctcctcgaagtcgataacagatcggtcgaactcgtcgaggaagacgggcggcaggtctac
gacggggacgacgtctctctcgaagagacgggcgacggctacaccctccgcgtcgggagc
gacgaagacgaactcgacgacgacgaactccgcgagacgctgctggacatgactgcgtac
gtccccagcatggacgacatcgtggactcgatggaggagttcgaggcggccaaggaggcc
gggaagggcgctatcgccatgacgcagtcgacgacgatagtcatcgacggcatcgaagtc
gaaatacgcaaagaccggatgtgggacgaagccacctatcaggcggcgcagacaccgatc
acgctgttccaagacgtctacgagcaccgtcccgaccagcacaacgaactcgcggagatg
tacggatcggacgtcgtcgaacgcgcgaccgacgtcggtaactga

DBGET integrated database retrieval system