Sinocyclocheilus rhinocerous: 107748812 Help Entry 107748812         CDS       T04916                                  Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism srx  Sinocyclocheilus rhinocerous Pathway srx03420   Nucleotide excision repair srx04110   Cell cycle srx04114   Oocyte meiosis srx04120   Ubiquitin mediated proteolysis srx04141   Protein processing in endoplasmic reticulum srx04310   Wnt signaling pathway srx04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:srx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     107748812    04120 Ubiquitin mediated proteolysis     107748812   09124 Replication and repair    03420 Nucleotide excision repair     107748812  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     107748812    04350 TGF-beta signaling pathway     107748812  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     107748812    04114 Oocyte meiosis     107748812  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:srx04121]     107748812    03400 DNA repair and recombination proteins [BR:srx03400]     107748812 Enzymes [BR:srx01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      107748812 Ubiquitin system [BR:srx04121]  Ubiquitin ligases (E3)   UBL E3 ligases    107748812   Multi subunit type E3    SCF complex     Ring finger protein      107748812    Cul2 complex      107748812    Cul3 complex      107748812    Cul4 complex      107748812    Cul7 complex      107748812    Cul8 complex      107748812    Cul9 complex      107748812 DNA repair and recombination proteins [BR:srx03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       107748812     TCR (transcription coupled repair) factors      Cul4-CSA complex       107748812 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  107748812 NCBI-ProteinID:  XP_016419263 UniProt:  A0A673ME93 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggctgcgatggatgtagacaccccgagtggaactaacagtggagccagtaaaaag cgttttgaagtgaaaaagtggaatgctgtggctctgtgggcttgggacattgtggtggac aactgtgccatctgcagaaatcacataatggacctctgtatagagtgtcaggccaatcag gcgtcggctacatcagaggagtgtacagtggcctggggagtctgtaatcatgcgtttcat ttccactgcatctctcgctggctgaagaccagacaggtgtgtcctctggacaatagagag tgggagttccagaagtatggccattag

DBGET integrated database retrieval system