Sus scrofa (pig): 100144492 Help Entry 100144492         CDS       T01009                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism ssc  Sus scrofa (pig) Pathway ssc01522   Endocrine resistance ssc04110   Cell cycle ssc04115   p53 signaling pathway ssc04151   PI3K-Akt signaling pathway ssc04218   Cellular senescence ssc04530   Tight junction ssc04660   T cell receptor signaling pathway ssc04933   AGE-RAGE signaling pathway in diabetic complications ssc04934   Cushing syndrome ssc05160   Hepatitis C ssc05162   Measles ssc05163   Human cytomegalovirus infection ssc05164   Influenza A ssc05165   Human papillomavirus infection ssc05166   Human T-cell leukemia virus 1 infection ssc05167   Kaposi sarcoma-associated herpesvirus infection ssc05169   Epstein-Barr virus infection ssc05200   Pathways in cancer ssc05203   Viral carcinogenesis ssc05212   Pancreatic cancer ssc05214   Glioma ssc05218   Melanoma ssc05219   Bladder cancer ssc05220   Chronic myeloid leukemia ssc05222   Small cell lung cancer ssc05223   Non-small cell lung cancer ssc05224   Breast cancer ssc05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     100144492 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100144492 (CDK4)    04115 p53 signaling pathway     100144492 (CDK4)    04218 Cellular senescence     100144492 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     100144492 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     100144492 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100144492 (CDK4)    05203 Viral carcinogenesis     100144492 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     100144492 (CDK4)    05225 Hepatocellular carcinoma     100144492 (CDK4)    05214 Glioma     100144492 (CDK4)    05220 Chronic myeloid leukemia     100144492 (CDK4)    05218 Melanoma     100144492 (CDK4)    05219 Bladder cancer     100144492 (CDK4)    05224 Breast cancer     100144492 (CDK4)    05222 Small cell lung cancer     100144492 (CDK4)    05223 Non-small cell lung cancer     100144492 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100144492 (CDK4)    05160 Hepatitis C     100144492 (CDK4)    05164 Influenza A     100144492 (CDK4)    05162 Measles     100144492 (CDK4)    05163 Human cytomegalovirus infection     100144492 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     100144492 (CDK4)    05169 Epstein-Barr virus infection     100144492 (CDK4)    05165 Human papillomavirus infection     100144492 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100144492 (CDK4)    04934 Cushing syndrome     100144492 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100144492 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ssc01001]     100144492 (CDK4) Enzymes [BR:ssc01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      100144492 (CDK4) Protein kinases [BR:ssc01001]  Serine/threonine kinases: CMGC group   CDK family    100144492 (CDK4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  100144492 NCBI-ProteinID:  NP_001116569 Ensembl:  ENSSSCG00000025092 UniProt:  P79432 LinkDB All DBs Position 5:complement(23039206..23041959) Genome browser AA seq 303 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKAEG NPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacctcccggtatgaaccagtggcggagattggtgttggtgcctatgggaccgtg tacaaagcacgggatccccacagtggccactttgtggccctcaagagcgtaagagtcccc aatggaggaggtgctggagggggcctgcccatcagcacggttcgtgaagtggccttactg cgccggctggaggctttcgagcatcccaatgttgtccggctgatggatgtctgtgccact gcccgaactgatcgagagaccaaagtgaccctggtgtttgagcatgtggaccaagatcta aggacatatctggacaaggcacccccaccaggcttgccggtggagaccatcaaggatctg atgcgtcagtttctaagaggcctagatttccttcatgccaactgcatcgttcatcgagac ctgaagccagagaacattctggttacaagtggtgggacagtcaagctggctgactttggc ctggccagaatctacagctaccagatggcacttacacctgtggtggttacactctggtac cgtgctccagaagttcttttgcagtctacgtatgcaacacctgtggacatgtggagcgtt ggctgtatcttcgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct gaccagttaggcaaaatctttgacctgattgggctgcccccagaggatgactggccccga gatgtgtctctaccccgaggagccttttcccccagagggccccgcccagtgcagtcggtg gtacctgagatggaggagtctggagcacagctgctactggagatgctgacttttaaccca cacaagcgaatctctgccttccgagccctgcagcactcttatctacataaggcagaaggt aacccagagtga

DBGET integrated database retrieval system