Sus scrofa (pig): 100517573 Help Entry 100517573         CDS       T01009                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism ssc  Sus scrofa (pig) Pathway ssc00510   N-Glycan biosynthesis ssc00513   Various types of N-glycan biosynthesis ssc04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ssc00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     100517573 (TMEM258)    00513 Various types of N-glycan biosynthesis     100517573 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100517573 (TMEM258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 Phage_holin_3_3 TctB Motif Other DBs NCBI-GeneID:  100517573 NCBI-ProteinID:  XP_003122674 Ensembl:  ENSSSCG00000027538 UniProt:  A0A4X1VMF9 A0A8D1MCK5 LinkDB All DBs Position 2:9756970..9760615 Genome browser AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagcttgaggccatgagcagatacaccagcccggtgaacccagccgtcttcccccac ctgacggtggtgctgttggccattggcatgttctttaccgcctggttcttcgtttatgaa gtcacctccaccaagtacactcgggatatctacaaagagcttctcatctctttggtggcc tcactcttcatgggctttggagtcctgttcctgctgctgtgggtcggcatctacgtatga

DBGET integrated database retrieval system