Sus scrofa (pig): 445459 Help Entry 445459            CDS       T01009                                  Symbol IFNB1 Name (RefSeq) interferon beta precursor   KO K05415   interferon beta Organism ssc  Sus scrofa (pig) Pathway ssc04060   Cytokine-cytokine receptor interaction ssc04151   PI3K-Akt signaling pathway ssc04217   Necroptosis ssc04380   Osteoclast differentiation ssc04620   Toll-like receptor signaling pathway ssc04621   NOD-like receptor signaling pathway ssc04622   RIG-I-like receptor signaling pathway ssc04623   Cytosolic DNA-sensing pathway ssc04630   JAK-STAT signaling pathway ssc04650   Natural killer cell mediated cytotoxicity ssc04668   TNF signaling pathway ssc04936   Alcoholic liver disease ssc05135   Yersinia infection ssc05142   Chagas disease ssc05152   Tuberculosis ssc05160   Hepatitis C ssc05161   Hepatitis B ssc05162   Measles ssc05163   Human cytomegalovirus infection ssc05164   Influenza A ssc05165   Human papillomavirus infection ssc05167   Kaposi sarcoma-associated herpesvirus infection ssc05168   Herpes simplex virus 1 infection ssc05169   Epstein-Barr virus infection ssc05170   Human immunodeficiency virus 1 infection ssc05171   Coronavirus disease - COVID-19 ssc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     445459 (IFNB1)    04668 TNF signaling pathway     445459 (IFNB1)    04151 PI3K-Akt signaling pathway     445459 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     445459 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     445459 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     445459 (IFNB1)    04621 NOD-like receptor signaling pathway     445459 (IFNB1)    04622 RIG-I-like receptor signaling pathway     445459 (IFNB1)    04623 Cytosolic DNA-sensing pathway     445459 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     445459 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     445459 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     445459 (IFNB1)    05161 Hepatitis B     445459 (IFNB1)    05160 Hepatitis C     445459 (IFNB1)    05171 Coronavirus disease - COVID-19     445459 (IFNB1)    05164 Influenza A     445459 (IFNB1)    05162 Measles     445459 (IFNB1)    05168 Herpes simplex virus 1 infection     445459 (IFNB1)    05163 Human cytomegalovirus infection     445459 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     445459 (IFNB1)    05169 Epstein-Barr virus infection     445459 (IFNB1)    05165 Human papillomavirus infection     445459 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     445459 (IFNB1)    05152 Tuberculosis     445459 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     445459 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     445459 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     445459 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ssc04052]     445459 (IFNB1) Cytokines and neuropeptides [BR:ssc04052]  Cytokines   Interferons    445459 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon SesA GerD Aip3p_Bud6_N Motif Other DBs NCBI-GeneID:  445459 NCBI-ProteinID:  NP_001003923 Ensembl:  ENSSSCG00000005163 Vega:  OTTSUSG00000001528 UniProt:  Q68IQ4 A0A8D0J9V5 LinkDB All DBs Position 1:201850935..201851495 Genome browser AA seq 186 aa AA seqDB search MANKCILQIALLMCFSTTALSMSYDVLRYQQRSSNLACQKLLEQLPGTPQYCLEDRMNFE VPEEIMQPPQFQKEDAVLIIHEMLQQIFGILRRNFSSTGWNETVIKTILVELDGQMDDLE TILEEIMEEENFPRGDMTILHLKKYYLSILQYLKSKEYRSCAWTVVQVEILRNFSFLNRL TDYLRN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atggctaacaagtgcatcctccaaatcgctctcctgatgtgtttctccaccacagctctt tccatgagctatgatgtgcttcgataccaacaaaggagcagcaatttggcatgtcagaag ctcctggaacagttgcctgggactcctcaatattgcctcgaagataggatgaacttcgag gtccctgaggagattatgcaaccaccacaattccagaaggaagatgcagtattgattatc cacgagatgctccagcagatcttcggcattctcagaagaaatttctctagcactggctgg aatgaaaccgtcattaagactatccttgtggaacttgatgggcagatggatgacctggag acaatcctggaggaaatcatggaggaggaaaatttccccaggggagacatgaccattctt cacctgaagaaatattacttgagcattctgcagtacctgaagtccaaggagtacagaagc tgtgcctggacagtcgtccaagtggaaatcctcaggaacttttctttccttaacagactt acagattacctccggaactga

DBGET integrated database retrieval system