Sporothrix schenckii: SPSK_02774 Help Entry SPSK_02774        CDS       T05555                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ssck  Sporothrix schenckii Pathway ssck03420   Nucleotide excision repair ssck04111   Cell cycle - yeast ssck04120   Ubiquitin mediated proteolysis ssck04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ssck00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     SPSK_02774    04120 Ubiquitin mediated proteolysis     SPSK_02774   09124 Replication and repair    03420 Nucleotide excision repair     SPSK_02774  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     SPSK_02774  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ssck04121]     SPSK_02774    03400 DNA repair and recombination proteins [BR:ssck03400]     SPSK_02774 Enzymes [BR:ssck01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      SPSK_02774 Ubiquitin system [BR:ssck04121]  Ubiquitin ligases (E3)   UBL E3 ligases    SPSK_02774   Multi subunit type E3    SCF complex     Ring finger protein      SPSK_02774    Cul2 complex      SPSK_02774    Cul3 complex      SPSK_02774    Cul4 complex      SPSK_02774    Cul7 complex      SPSK_02774    Cul8 complex      SPSK_02774    Cul9 complex      SPSK_02774 DNA repair and recombination proteins [BR:ssck03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       SPSK_02774     TCR (transcription coupled repair) factors      Cul4-CSA complex       SPSK_02774 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 PHD_NSD Motif Other DBs NCBI-GeneID:  27664916 NCBI-ProteinID:  XP_016589046 UniProt:  A0A0F2MC09 LinkDB All DBs Position Unknown AA seq 122 aa AA seqDB search MADVDMADAPPSVAVVKKKTGAAGEPGKTLDDKKRFEVKKWNAVALWAWDIVVDNCAICR NHIMDLCIECQANQSSATSEECTVAWGICNHAFHFHCISRWLKARQVCPLDNRDWEFQKY GR NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggccgacgtggacatggctgacgcgccgccgtcagttgccgtcgtgaagaagaagacc ggcgctgccggcgagcctggcaagaccctcgatgataagaagcgcttcgaggtgaagaag tggaatgccgttgctctgtgggcgtgggacatcgtcgtcgacaactgcgccatctgcaga aatcacatcatggatttgtgcatagaatgtcaagcgaaccagtcatcggcgaccagtgag gagtgcaccgtcgcctggggtatttgcaaccacgcattccacttccattgcatctcccgc tggctcaaggcccgccaagtgtgtcctctcgacaaccgagactgggagttccagaagtac ggccgttaa

DBGET integrated database retrieval system