Solea senegalensis (Senegalese sole): 122760528 Help Entry 122760528         CDS       T07721                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism ssen  Solea senegalensis (Senegalese sole) Pathway ssen00510   N-Glycan biosynthesis ssen00513   Various types of N-glycan biosynthesis ssen04141   Protein processing in endoplasmic reticulum Module ssen_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:ssen00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     122760528 (tmem258)    00513 Various types of N-glycan biosynthesis     122760528 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     122760528 (tmem258) SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  122760528 NCBI-ProteinID:  XP_043871549 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaactcgaagctatgaccaggtacaccagcccggtgaacccggctgtgttccctcac ctgaccgtcgttctgctggccatcggcatgttctttaccgcctggttcttcgtttatgag gtgacttcaacaaaatacaccagggacgtctacaaagagctgctgatctcacttgtggct tcactttttatgggctttggggtgctatttttattactctgggtcggcatttatgtatga

DBGET integrated database retrieval system