Solea senegalensis (Senegalese sole): 122785647 Help Entry 122785647         CDS       T07721                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ssen  Solea senegalensis (Senegalese sole) Pathway ssen03420   Nucleotide excision repair ssen04110   Cell cycle ssen04114   Oocyte meiosis ssen04120   Ubiquitin mediated proteolysis ssen04141   Protein processing in endoplasmic reticulum ssen04310   Wnt signaling pathway ssen04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:ssen00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     122785647 (rbx1)    04120 Ubiquitin mediated proteolysis     122785647 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     122785647 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     122785647 (rbx1)    04350 TGF-beta signaling pathway     122785647 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ssen04121]     122785647 (rbx1)    03400 DNA repair and recombination proteins [BR:ssen03400]     122785647 (rbx1) Enzymes [BR:ssen01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      122785647 (rbx1) Ubiquitin system [BR:ssen04121]  Ubiquitin ligases (E3)   UBL E3 ligases    122785647 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      122785647 (rbx1)    Cul2 complex      122785647 (rbx1)    Cul3 complex      122785647 (rbx1)    Cul4 complex      122785647 (rbx1)    Cul7 complex      122785647 (rbx1)    Cul8 complex      122785647 (rbx1)    Cul9 complex      122785647 (rbx1) DNA repair and recombination proteins [BR:ssen03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       122785647 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       122785647 (rbx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  122785647 NCBI-ProteinID:  XP_043907477 LinkDB All DBs Position LG19:complement(16275214..16277646) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGTSKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcagcagcgatggatgtggatacaccgagcggtacaaatagcggaacaagcaagaaa cgattcgaagtgaagaagtggaatgccgtggctctgtgggcgtgggacattgtcgtagat aactgtgctatctgtcgaaaccacatcatggatctctgtatagaatgccaggccaaccaa gcttctgccacttctgaagagtgcactgtggcctggggtgtctgcaatcacgccttccat ttccactgtatttctcgctggctgaaaaccagacaggtgtgccctctggacaacagggag tgggagtttcagaaatatggacactaa

DBGET integrated database retrieval system