KEGG   Streptomyces alfalfae: A7J05_09235
Entry
A7J05_09235       CDS       T05110                                 
Name
(GenBank) cytochrome P450
  KO
K15907  pentalenene oxygenase [EC:1.14.15.32]
Organism
ssia  Streptomyces alfalfae
Pathway
ssia00909  Sesquiterpenoid and triterpenoid biosynthesis
ssia00998  Biosynthesis of various antibiotics
ssia01100  Metabolic pathways
ssia01110  Biosynthesis of secondary metabolites
Module
ssia_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    A7J05_09235
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    A7J05_09235
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ssia00199]
    A7J05_09235
Enzymes [BR:ssia01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.32  pentalenene oxygenase
     A7J05_09235
Cytochrome P450 [BR:ssia00199]
 Cytochrome P450, bacteria type
  CYP183 family
   A7J05_09235
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: APY85874
UniProt: A0A1P8TE57
LinkDB
Position
complement(2307434..2308804)
AA seq 456 aa
MAQQTAQPEQQTFVAGTAPGAAPLVGHAWQMMRRPLQFMSSLSRHGDLVKIRLGPTEAHV
PTHPALLRQVLTSDNEYDKGGIFYDRARDIAGNGLVTCPYADHRRQRRLMQSAFTRPQLK
RYASAMHAEIETTAERWSDGAVVDAFPEMYGMALRTVGRTLYSTPVSKELADSVERAFDA
VLKGLFRQMFLPAAVRRMPSPGNRRYRANLDYLHRTTQTLIDDYRRDGADHDDLLSALLD
SRDEDGGRLGDKEIHDQVITVMAAGTETVAATLTWIFYLLSKYPRIEKALYAEIDEVLGG
RAPEFDDVARLQLTDRIITETLRLYPPAWLFTRLTATDLDVAGLRLPAGSTVVFSPAAVA
LDAGSFPHERRFDPDRWLPDRVTPQARQSFMAFGTGARKCIGDLYARTEATLALATILST
WRVTCEPGVDVRPVPLATVYQPRRLRLRLTARTPGA
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggcccagcagaccgcccagcccgagcagcagaccttcgtcgcgggcacggcgcccgga
gcggcgcccctcgtcgggcacgcctggcagatgatgcgccgcccgctgcagttcatgtcg
tcgctgtcccgccacggcgacctggtgaagatacgcctgggccccaccgaggcccatgtg
ccgacccatccggccctgctccgccaggtcctgaccagcgacaacgagtacgacaagggc
ggcatcttctacgacagggcccgtgacatcgcgggcaacggcctggtcacctgcccctac
gccgaccaccgccggcagagaaggctgatgcagtcggcgttcacccgcccccagctcaag
cggtacgcgtccgcgatgcacgccgagatcgagaccaccgccgagcgctggagcgacggc
gcggtggtcgacgcctttcccgagatgtacggcatggccctgcgcaccgtgggccgcacg
ctgtactcgacgccggtcagcaaggagctggccgacagcgtggagcgcgccttcgacgcc
gtgctcaagggactgttccggcagatgttcctgcccgcggcggtgcgcaggatgcccagt
ccgggcaaccggcgctaccgcgccaacctggactacctgcaccgcaccacccagacgctg
atcgacgactaccgccgcgacggcgccgaccacgacgacctgctctccgccctcctcgac
tcgcgcgacgaggacggcggcaggctcggcgacaaggagatccacgaccaggtcatcacc
gtgatggcggccggcacggagaccgtcgccgccaccctcacctggatcttctacctgctc
tccaagtacccgcggatcgagaaggcgctgtacgcggagatcgacgaggtcctgggcggc
agagccccggagttcgacgacgtggcccggctccagctcaccgaccgcatcatcaccgag
accctgcggctctacccgccggcctggctcttcacccggctgaccgccaccgacctcgac
gtggcggggctgcggctgcccgccggttccaccgtggtgttcagcccggcggccgtggcc
ctcgacgccggatctttcccccacgagcggcggttcgaccccgaccgctggctgcccgac
cgggtgacaccgcaggcccggcagtccttcatggccttcggcaccggcgcccgcaagtgc
atcggcgacctctacgcccgcaccgaggccaccctcgcgctcgccaccatcctcagcacc
tggcgggtcacctgcgaaccgggcgtcgacgtgcgccccgtcccgctggccaccgtctac
cagccacgccggctgcgcctgcgactgacggcccgtacgcccggggcgtag

DBGET integrated database retrieval system