Streptococcus suis D12 (serotype 9): SSUD12_0787 Help Entry SSUD12_0787       CDS       T02021                                  Symbol folQ Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ssk  Streptococcus suis D12 (serotype 9) Pathway ssk00790   Folate biosynthesis ssk01100   Metabolic pathways ssk01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:ssk00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     SSUD12_0787 (folQ) Enzymes [BR:ssk01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      SSUD12_0787 (folQ)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      SSUD12_0787 (folQ)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      SSUD12_0787 (folQ) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AER19102 UniProt:  G7SFN3 LinkDB All DBs Position 803415..803777 Genome browser AA seq 120 aa AA seqDB search MDKISLNKCRFYGYHGAFKEEQVLGQIFTVDCDLFVDLTAASQTDNLEDTVHYGMVFETI KAVVEGKPYILIEKVAGVICQELFDQFPKVEKIRLAIYKENPPIAGHYDSVGIELERERP NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggataagatttctcttaataaatgccgcttttacggctaccatggtgccttcaaagaa gaacaagttcttggtcaaattttcacagttgactgtgatttgtttgttgacctgacagca gcttcacaaactgacaatttagaagacacagttcactatggtatggtctttgaaaccatt aaagcagttgtggaaggcaagccctacatccttatagaaaaggtagcaggtgttatttgt caggagctttttgatcaatttccaaaggtggagaagattcgcttggccatttacaaggaa aatccacccattgctggacactatgattctgtcggaattgaattggagcgtgaacgacca tga

DBGET integrated database retrieval system