KEGG   Sclerotinia sclerotiorum: SS1G_00406
Entry
SS1G_00406        CDS       T01071                                 
Name
(RefSeq) cytochrome P450
  KO
K15877  fungal nitric oxide reductase [EC:1.7.1.14]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00910  Nitrogen metabolism
ssl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    SS1G_00406
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ssl00199]
    SS1G_00406
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.14  nitric oxide reductase [NAD(P)+, nitrous oxide-forming]
     SS1G_00406
Cytochrome P450 [BR:ssl00199]
 Cytochrome P450, fungi type
  CYP55 family
   SS1G_00406
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 5494611
NCBI-ProteinID: XP_001598320
UniProt: A7E534 A0A1D9PZ53
LinkDB
Position
Unknown
AA seq 402 aa
MTEEYPHFPFTRLSGVDPAPENAKFRRICPVTRVELFDGKEVWLFTKYKDCCEILASQDF
SADRRQDGYPEIHEGGKVAALASAPTFVNLDDPAHFLQRNRIQPFFEKEAIDKLRPFIQS
IVDRTLDQMIAEGCSSPVDLIHKFAAPIPTLTVYHTLGIPEEDIEKLAYDSEVRNSTSRN
AAENSNTNLQGYIKELTERKMVDPGDDLVSELINQYNQGIGNLSDISSLAYLVLVAGNAA
VINTIALGILTLQQHPSQLSELIANPDLAPQVVNEICRYHTASALNCRRVALKDMKIGGQ
KIKKGEGVICAVQAADRDEDFFTDPDAETFNIHRNHDIKDVLGFGYGIHRCQAEWLSKAE
LEIIFGTLYKRLPNLKIAVPLDDLKYTPPTQNIGILELPVTW
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgactgaggaatatccacacttccccttcacacgcctctcaggtgttgaccccgctcct
gaaaatgcaaaatttcgtcgcatatgtccggttactcgggttgaattgttcgatgggaag
gaagtgtggttatttactaaatataaggattgttgtgagattcttgcttcgcaggatttt
tcggctgatcggagacaagatggatatcccgagattcatgaagggggaaaagtagctgca
ttggcttctgcacctacttttgtgaatttggatgatccggcgcattttctgcaacgcaat
cgaatacaacctttcttcgaaaaagaagccatagataaacttcgtccttttatccaatcc
atcgtcgatagaacgcttgatcaaatgatcgcagaaggatgttcttctcctgttgatttg
attcataaattcgcagctccaattcctacattgactgtgtatcatacgttggggatacca
gaggaggatattgagaaattggcttatgatagtgaggtgaggaatagtacgagtaggaat
gcggctgaaaattcgaataccaatcttcagggatatattaaagaattgacggagagaaag
atggttgacccgggagatgatcttgttagcgaacttattaatcagtacaatcaagggatc
ggtaatctctcggatatttcatctctcgcgtatttagttctagtagccggtaatgcagca
gtcataaatactattgcacttggcatccttactcttcaacaacatccctctcaactctcc
gagctaattgctaatccggacctcgcaccacaagtagtcaatgagatttgtaggtatcat
actgcgagtgcattgaattgtagacgagtagctttgaaggatatgaaaatcggaggtcag
aagattaagaaaggtgaaggtgtgatatgcgcagtccaagcagcggatagggatgaagat
ttcttcacggatcctgatgccgaaacgtttaatatccatcggaatcatgatattaaagat
gtattggggtttggatatggcattcatcgatgccaagcggaatggttgagtaaagctgag
ttggagattatttttggtacattatataaacgtctaccaaatctgaaaattgcggttccg
ttggatgatttaaagtatacaccgccaacacagaatattgggatattggaattaccagtg
acctggtag

DBGET integrated database retrieval system