Solea solea (common sole): 131455660 Help Entry 131455660         CDS       T10853                                  Name (RefSeq) thymosin beta-12   KO K05764   thymosin, beta 4 Organism ssoe  Solea solea (common sole) Pathway ssoe04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:ssoe00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     131455660  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ssoe04812]     131455660 Cytoskeleton proteins [BR:ssoe04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      131455660 SSDB OrthologParalogGFIT Motif Pfam:  Thymosin Motif Other DBs NCBI-GeneID:  131455660 NCBI-ProteinID:  XP_058479451 LinkDB All DBs Position 2:complement(11130785..11132898) Genome browser AA seq 41 aa AA seqDB search MSDKPDISEVTKFDKSKLKKTETQEKNPLPTKETIEQEKQS NT seq 126 nt NT seq  +upstreamnt  +downstreamnt atgtccgacaagcccgacatctctgaggtgaccaaattcgacaagagcaagctgaagaag acggagacgcaggagaagaatccactacctacaaaagagaccatcgagcaggaaaagcag tcgtga

DBGET integrated database retrieval system