Salvia splendens (scarlet sage): 121746682 Help Entry 121746682         CDS       T07627                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sspl  Salvia splendens (scarlet sage) Pathway sspl03420   Nucleotide excision repair sspl04120   Ubiquitin mediated proteolysis sspl04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sspl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121746682    04120 Ubiquitin mediated proteolysis     121746682   09124 Replication and repair    03420 Nucleotide excision repair     121746682  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sspl04121]     121746682    03400 DNA repair and recombination proteins [BR:sspl03400]     121746682 Enzymes [BR:sspl01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      121746682 Ubiquitin system [BR:sspl04121]  Ubiquitin ligases (E3)   UBL E3 ligases    121746682   Multi subunit type E3    SCF complex     Ring finger protein      121746682    Cul2 complex      121746682    Cul3 complex      121746682    Cul4 complex      121746682    Cul7 complex      121746682    Cul8 complex      121746682    Cul9 complex      121746682 DNA repair and recombination proteins [BR:sspl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       121746682     TCR (transcription coupled repair) factors      Cul4-CSA complex       121746682 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  121746682 NCBI-ProteinID:  XP_041996531 LinkDB All DBs Position 9:complement(28438576..28441522) Genome browser AA seq 122 aa AA seqDB search MATLDTDVNMVPAGEGSSGAGPSNTTPQSSKKSKKFEIKKWNAVSLWAWDIVVDNCAICR NHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKY GH NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggcgacactcgacaccgacgtcaacatggttccggctggagagggctcatccggcgcc ggcccttccaataccacgccacagtcctccaagaaatccaagaaatttgagatcaaaaag tggaacgccgtctcgctctgggcctgggatatcgtggtcgataattgtgctatttgcagg aaccatatcatggatctatgcattgagtgccaggctaatcaagccagtgcgacgagcgag gaatgcactgttgcttggggggtttgcaaccatgccttccacttccattgcatcagcagg tggcttaagactcgccaagtttgccctcttgataacagtgagtgggagtttcagaagtat ggccactag

DBGET integrated database retrieval system