Salvia splendens (scarlet sage): 121750403 Help Entry 121750403         CDS       T07627                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sspl  Salvia splendens (scarlet sage) Pathway sspl03420   Nucleotide excision repair sspl04120   Ubiquitin mediated proteolysis sspl04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sspl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121750403    04120 Ubiquitin mediated proteolysis     121750403   09124 Replication and repair    03420 Nucleotide excision repair     121750403  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sspl04121]     121750403    03400 DNA repair and recombination proteins [BR:sspl03400]     121750403 Enzymes [BR:sspl01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      121750403 Ubiquitin system [BR:sspl04121]  Ubiquitin ligases (E3)   UBL E3 ligases    121750403   Multi subunit type E3    SCF complex     Ring finger protein      121750403    Cul2 complex      121750403    Cul3 complex      121750403    Cul4 complex      121750403    Cul7 complex      121750403    Cul8 complex      121750403    Cul9 complex      121750403 DNA repair and recombination proteins [BR:sspl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       121750403     TCR (transcription coupled repair) factors      Cul4-CSA complex       121750403 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  121750403 NCBI-ProteinID:  XP_042000868 LinkDB All DBs Position 10:complement(23756310..23758138) Genome browser AA seq 122 aa AA seqDB search MASLDTDVNMVPAGEGSSGAGPSNTAPQPSKKSKKFEIKKWNAVSLWAWDIVVDNCAICR NHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKY GH NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggcgtcactcgacaccgacgtcaacatggttccggctggagagggctcatccggcgcc ggcccttccaacaccgcgccacagccctccaagaaatccaagaaatttgagatcaaaaag tggaacgccgtctcgctctgggcttgggatatcgtggtcgataattgtgctatttgcagg aaccatatcatggatctatgcattgagtgccaggctaatcaagccagtgcgacgagcgag gaatgcaccgttgcttggggggtttgcaaccatgccttccacttccattgcatcagcagg tggcttaagactcgccaagtttgccctcttgataacagtgagtgggagtttcagaagtat ggccactag

DBGET integrated database retrieval system