KEGG   Salvia splendens (scarlet sage): 121755010
Entry
121755010         CDS       T07627                                 
Name
(RefSeq) terpene synthase 10-like
  KO
K21925  (-)-camphene/tricyclene/(4S)-limonene/myrcene synthase [EC:4.2.3.117 4.2.3.105 4.2.3.16 4.2.3.15]
Organism
sspl  Salvia splendens (scarlet sage)
Pathway
sspl00902  Monoterpenoid biosynthesis
sspl01100  Metabolic pathways
sspl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sspl00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    121755010
Enzymes [BR:sspl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.15  myrcene synthase
     121755010
    4.2.3.16  (4S)-limonene synthase
     121755010
    4.2.3.105  tricyclene synthase
     121755010
    4.2.3.117  (-)-camphene synthase
     121755010
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth RsbU_N DUF3772
Other DBs
NCBI-GeneID: 121755010
NCBI-ProteinID: XP_042006230
LinkDB
Position
11:complement(33470933..33474082)
AA seq 595 aa
MSSIIMSMAIPNKPTKLVHNFANKYPKTQIASSQKGWRQSCSLKHTADQTSDQIQSTRRS
GNYKPTLWDFNRIQSLTSVYTEEKYATRASELVEQLKKQLCQESNWLKQLELIDDLHKLG
VSYHFDNEINQVLNRIYMEQKYCNNEERDLYSTALAFRLLRQNGFRVSQDVFDGFKNDGG
EFKECLGGDTEGVLQLYEASFLLTEGETSLEQARLFSKNLLQKKLDDEEVLDEFLSSLVR
RSLELPLHWSVQRPNARWFANAYSKKSQANPILVELAKLDFNIVQAAYQEELKEISRWWK
ETELAEKLPFARDRVLENYIWNIGLLFKPQYGYARIMTTKLFILITVIDDVFDVYATLEE
TQLFKNATQRWDDEAVDQLPYYMQICYMALDSFINDMAYHILKEKGVFVIQDLRKTWGDL
CAAYAKEAEWYHTGYKPTMEEYINVAWVSISAHTILTHVFYLISNPIEKEAAESLRNYHD
IARHSAMVLRLADDLGTSPYEMQRGDVPKAVECYMNETGASREEAREHVMRMIREIWMKT
NEERFRESPFSDDFIRSAADLGRQAQYMYQHGDGHGISNPEMKERILGLIFQPIV
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgtctagcattataatgagcatggcgattcccaacaagccaacaaaacttgttcataac
tttgccaataaatatcccaaaacgcagatagcttcttcacaaaaaggctggaggcagtct
tgctccctcaaacacaccgccgatcaaacctccgatcaaatccaatctacacggcggtcg
ggtaattacaagcctaccctttgggatttcaatcggattcagtcactcaccagtgtatac
acggaagagaagtacgccacccgggcttctgagctcgttgagcaattgaagaagcagctg
tgccaagaatcaaattggctcaagcagttggagttgatcgatgacttgcacaaactaggg
gtttcttaccatttcgacaacgaaatcaaccaagtcttgaatcgtatctatatggagcag
aaatattgcaacaatgaggagagggatctgtactcaacagctcttgctttcagactcctc
agacaaaatggttttagggtttctcaagacgtgtttgatggtttcaagaacgacggcggc
gagttcaaagaatgcctaggtggtgatacagaaggagtgttgcaactctatgaagcttct
ttccttttaacggaaggcgaaacaagtcttgagcaagccagattattttccaaaaatctt
ctgcagaaaaaactggacgacgaagaagtattggatgaatttctctcctcgttggtgcgc
cgttctctagagcttcctcttcactggagcgttcaaaggccgaacgccagatggtttgcc
aacgcgtactcgaagaaatcacaggcaaatcccatccttgttgagcttgccaaattggat
ttcaacattgttcaagcagcataccaagaggaactcaaagaaatctcgagatggtggaag
gaaacggagctagcagaaaaacttccgtttgcaagagatagggtgcttgagaactacata
tggaacataggcttgctgttcaagcctcaatatggatatgcaagaatcatgacaacaaag
cttttcattttgataacagtaattgatgatgtatttgatgtctatgccaccttggaagaa
acacaacttttcaagaacgccactcaaagatgggatgatgaagcggtagatcaactccca
tactacatgcagatttgttatatggcgttggacagtttcatcaatgacatggcataccat
attcttaaggaaaagggcgttttcgtcattcaagatttaagaaaaacgtggggagatttg
tgtgcagcatacgcaaaagaggcagagtggtaccacactgggtataaaccaacaatggag
gaatacatcaacgttgcttgggtttcgatatcagcacacaccattttaactcatgtattt
tatctcatttcaaatccaatcgaaaaggaggctgctgagagcttgcgtaactatcatgac
atcgctcgtcactcagcaatggttctacgccttgcagatgatcttggaacatcaccgtat
gagatgcaaagaggtgatgtgccaaaagcagtggagtgctacatgaatgagacgggagct
tcgagagaggaggctcgcgaacatgtgatgcgtatgataagagaaatatggatgaagacg
aatgaagagagatttagggaatctccattttcagatgattttattagaagtgcagctgat
cttggaagacaagcacagtatatgtaccaacatggcgatggccatgggattagtaatccg
gagatgaaggagcgtattttaggtttgatatttcaacctattgtttag

DBGET integrated database retrieval system