Salvia splendens (scarlet sage): 121783554 Help Entry 121783554         CDS       T07627                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sspl  Salvia splendens (scarlet sage) Pathway sspl03420   Nucleotide excision repair sspl04120   Ubiquitin mediated proteolysis sspl04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sspl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121783554    04120 Ubiquitin mediated proteolysis     121783554   09124 Replication and repair    03420 Nucleotide excision repair     121783554  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sspl04121]     121783554    03400 DNA repair and recombination proteins [BR:sspl03400]     121783554 Enzymes [BR:sspl01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      121783554 Ubiquitin system [BR:sspl04121]  Ubiquitin ligases (E3)   UBL E3 ligases    121783554   Multi subunit type E3    SCF complex     Ring finger protein      121783554    Cul2 complex      121783554    Cul3 complex      121783554    Cul4 complex      121783554    Cul7 complex      121783554    Cul8 complex      121783554    Cul9 complex      121783554 DNA repair and recombination proteins [BR:sspl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       121783554     TCR (transcription coupled repair) factors      Cul4-CSA complex       121783554 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  121783554 NCBI-ProteinID:  XP_042037597 LinkDB All DBs Position 21:20240130..20243717 Genome browser AA seq 123 aa AA seqDB search MATLDTDVDMVPAGDGSSGAGPSNINPSSSTKKPKRFEIKKWNAVSLWAWDIVVDNCAIC RNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQK YGH NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggccacgcttgataccgacgtcgatatggttcccgccggcgatggatcctccggcgcc gggccctccaacatcaatccctcatcgtccaccaagaaaccaaagcgattcgagatcaag aagtggaacgccgtctctctatgggcttgggatatcgtggtcgataattgtgccatttgc aggaatcatatcatggatctttgcattgagtgccaggctaatcaggccagcgcaacaagc gaggaatgcacagtggcatggggtgtatgcaatcatgccttccacttccattgcattagc agatggctcaagacccgtcaagtttgtcctctggataatagtgagtgggagtttcagaag tatggtcactag

DBGET integrated database retrieval system