Salvia splendens (scarlet sage): 121801447 Help Entry 121801447         CDS       T07627                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sspl  Salvia splendens (scarlet sage) Pathway sspl03420   Nucleotide excision repair sspl04120   Ubiquitin mediated proteolysis sspl04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sspl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121801447    04120 Ubiquitin mediated proteolysis     121801447   09124 Replication and repair    03420 Nucleotide excision repair     121801447  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sspl04121]     121801447    03400 DNA repair and recombination proteins [BR:sspl03400]     121801447 Enzymes [BR:sspl01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      121801447 Ubiquitin system [BR:sspl04121]  Ubiquitin ligases (E3)   UBL E3 ligases    121801447   Multi subunit type E3    SCF complex     Ring finger protein      121801447    Cul2 complex      121801447    Cul3 complex      121801447    Cul4 complex      121801447    Cul7 complex      121801447    Cul8 complex      121801447    Cul9 complex      121801447 DNA repair and recombination proteins [BR:sspl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       121801447     TCR (transcription coupled repair) factors      Cul4-CSA complex       121801447 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  121801447 NCBI-ProteinID:  XP_042056872 LinkDB All DBs Position 4:complement(39533039..39535533) Genome browser AA seq 122 aa AA seqDB search MSTLDTDVNMVPAGEGSSGAGPSTTTPHSCKKSKKFEIKKWNAVSLWAWDIVVDNCAICR NHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKY GH NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgtcgacactcgacaccgacgtcaacatggttccggccggagagggctcatccggcgcc ggcccttccactaccacgccgcactcctgcaagaaatctaagaaattcgagattaaaaag tggaacgccgtctcgctttgggcttgggatatcgtggtcgataattgtgctatttgcagg aaccacatcatggatctatgcattgagtgccaggctaatcaagctagtgcgacgagcgag gaatgcacggttgcttggggggtttgcaaccatgctttccacttccactgcatcagcagg tggcttaagactcgccaagtttgtcctcttgacaacagcgagtgggagtttcagaagtat ggccactag

DBGET integrated database retrieval system