Salvia splendens (scarlet sage): 121804762 Help Entry 121804762         CDS       T07627                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism sspl  Salvia splendens (scarlet sage) Pathway sspl00510   N-Glycan biosynthesis sspl00513   Various types of N-glycan biosynthesis sspl04141   Protein processing in endoplasmic reticulum Module sspl_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:sspl00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     121804762    00513 Various types of N-glycan biosynthesis     121804762  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     121804762 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  121804762 NCBI-ProteinID:  XP_042060347 LinkDB All DBs Position 5:complement(14440836..14443141) Genome browser AA seq 78 aa AA seqDB search MAPSGKPISSPVPDAWYPTLAVILLAFGLAITAFFFIYEATSSRKNRNLAKELTTGVFAS VFLGFGSLFLLLSSGVYV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcgccgtcagggaaaccgatctcaagcccagttccagatgcgtggtaccccactctc gccgtaattctgctcgccttcggccttgccatcaccgcctttttcttcatttatgaagct acttcctctaggaaaaatcgcaatcttgcaaaggaattgactactggtgtgtttgcatca gttttcctgggttttggatctctgttcttgctgctctcttctggtgtctatgtttga

DBGET integrated database retrieval system