Solanum stenotomum: 125862246 Help Entry 125862246         CDS       T08385                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism sstn  Solanum stenotomum Pathway sstn03420   Nucleotide excision repair sstn04120   Ubiquitin mediated proteolysis sstn04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:sstn00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     125862246    04120 Ubiquitin mediated proteolysis     125862246   09124 Replication and repair    03420 Nucleotide excision repair     125862246  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sstn04121]     125862246    03400 DNA repair and recombination proteins [BR:sstn03400]     125862246 Enzymes [BR:sstn01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      125862246 Ubiquitin system [BR:sstn04121]  Ubiquitin ligases (E3)   UBL E3 ligases    125862246   Multi subunit type E3    SCF complex     Ring finger protein      125862246    Cul2 complex      125862246    Cul3 complex      125862246    Cul4 complex      125862246    Cul7 complex      125862246    Cul8 complex      125862246    Cul9 complex      125862246 DNA repair and recombination proteins [BR:sstn03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       125862246     TCR (transcription coupled repair) factors      Cul4-CSA complex       125862246 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  125862246 NCBI-ProteinID:  XP_049398236 LinkDB All DBs Position 4:65556709..65560787 Genome browser AA seq 116 aa AA seqDB search MASPDTDVPMVPAGESSTGAGTSNKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNHIMDL CIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcgtcaccggataccgacgtgccgatggttcccgccggcgagagttcaaccggagct ggaacgtctaacaaaaagccgaagcgatttgagatcaaaaagtggaacgctgtttctctc tgggcttgggatattgtggtagataattgtgccatctgtaggaatcacatcatggatctg tgtatcgagtgtcaagctaatcaagctagcgcaacaagtgaggaatgcacagttgcttgg ggtgtttgcaaccatgcattccacttccattgcattagtaggtggctcaaaactcgtcaa gtgtgtccacttgataacagcgagtgggagtttcagaagtacggtcactag

DBGET integrated database retrieval system