Streptococcus suis GZ1 (serotype 2): SSGZ1_1004 Help Entry SSGZ1_1004        CDS       T02023                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ssw  Streptococcus suis GZ1 (serotype 2) Pathway ssw00790   Folate biosynthesis ssw01100   Metabolic pathways ssw01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:ssw00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     SSGZ1_1004 Enzymes [BR:ssw01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      SSGZ1_1004  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      SSGZ1_1004  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      SSGZ1_1004 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ADE31461 UniProt:  D5AHZ6 LinkDB All DBs Position complement(1039299..1039661) Genome browser AA seq 120 aa AA seqDB search MDKISLNKCRFYGYHGAFKEEQVLGQIFTVDCDLFVDLTAASQTDNLEDTVHYGMVFETI KAVVEGKPYILIEKVAGVICQEIFDQFPKVEKIRLAIYKENPPIAGHYDSVGIELERERP NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggataagatttctctcaataaatgtcgcttttacggctaccatggtgccttcaaagaa gaacaagttcttggtcaaattttcacagttgactgtgatttgtttgttgacctgacagca gcttcacaaactgacaatttagaagacacagttcactatggtatggtctttgaaaccatt aaagcagttgtggaaggcaagccctatattctcattgaaaaggtggcaggtgtcatctgt caggagatttttgatcaatttccaaaggtggagaagattcgcttggccatttacaaggaa aatccgcccattgctggacactatgattctgtcggaattgaattggagcgtgaacgacca tga

DBGET integrated database retrieval system