Symphalangus syndactylus (siamang): 129458182 Help Entry 129458182         CDS       T10134                                  Symbol IL10 Name (RefSeq) interleukin-10 isoform X2   KO K05443   interleukin 10 Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn04060   Cytokine-cytokine receptor interaction ssyn04061   Viral protein interaction with cytokine and cytokine receptor ssyn04068   FoxO signaling pathway ssyn04148   Efferocytosis ssyn04625   C-type lectin receptor signaling pathway ssyn04630   JAK-STAT signaling pathway ssyn04660   T cell receptor signaling pathway ssyn04672   Intestinal immune network for IgA production ssyn05133   Pertussis ssyn05135   Yersinia infection ssyn05140   Leishmaniasis ssyn05142   Chagas disease ssyn05143   African trypanosomiasis ssyn05144   Malaria ssyn05145   Toxoplasmosis ssyn05146   Amoebiasis ssyn05150   Staphylococcus aureus infection ssyn05152   Tuberculosis ssyn05310   Asthma ssyn05320   Autoimmune thyroid disease ssyn05321   Inflammatory bowel disease ssyn05322   Systemic lupus erythematosus ssyn05330   Allograft rejection Brite KEGG Orthology (KO) [BR:ssyn00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     129458182 (IL10)    04068 FoxO signaling pathway     129458182 (IL10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129458182 (IL10)    04061 Viral protein interaction with cytokine and cytokine receptor     129458182 (IL10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     129458182 (IL10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129458182 (IL10)    04660 T cell receptor signaling pathway     129458182 (IL10)    04672 Intestinal immune network for IgA production     129458182 (IL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     129458182 (IL10)    05133 Pertussis     129458182 (IL10)    05150 Staphylococcus aureus infection     129458182 (IL10)    05152 Tuberculosis     129458182 (IL10)   09174 Infectious disease: parasitic    05146 Amoebiasis     129458182 (IL10)    05144 Malaria     129458182 (IL10)    05145 Toxoplasmosis     129458182 (IL10)    05140 Leishmaniasis     129458182 (IL10)    05142 Chagas disease     129458182 (IL10)    05143 African trypanosomiasis     129458182 (IL10)   09163 Immune disease    05310 Asthma     129458182 (IL10)    05322 Systemic lupus erythematosus     129458182 (IL10)    05320 Autoimmune thyroid disease     129458182 (IL10)    05321 Inflammatory bowel disease     129458182 (IL10)    05330 Allograft rejection     129458182 (IL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ssyn04052]     129458182 (IL10)    00536 Glycosaminoglycan binding proteins [BR:ssyn00536]     129458182 (IL10) Cytokines and neuropeptides [BR:ssyn04052]  Cytokines   Interleukins    129458182 (IL10) Glycosaminoglycan binding proteins [BR:ssyn00536]  Heparan sulfate / Heparin   Cytokines    129458182 (IL10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL10 IL22 ALIX_LYPXL_bnd Motif Other DBs NCBI-GeneID:  129458182 NCBI-ProteinID:  XP_055089852 LinkDB All DBs Position 12:16282315..16297807 Genome browser AA seq 178 aa AA seqDB search MHSSALLCCLVLLTGVRASPGQATQSENSCTHFPGSLPNMLRELRDAFSRVKTFFQMKDQ LDNMLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKEHVNSLGEKLKALR LRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIQN NT seq 537 nt NT seq  +upstreamnt  +downstreamnt atgcacagctcagcactgctctgttgcctggtcctcctgactggagtgagggccagccca ggccaggccacccagtctgagaacagctgcacccacttcccaggcagcctgcctaacatg cttcgagagctccgagacgccttcagcagagtgaagactttctttcaaatgaaggatcag ctggacaacatgttgttgaaggagtccttgctggaggactttaagggttacctgggttgc caagccttgtctgagatgatccagttttacctggaggaggtgatgccccaagctgagaac caagacccagacatcaaggagcatgtgaactccctgggggagaagctgaaggccctcagg ctgaggctacggcgctgtcatcgatttcttccctgtgaaaacaagagcaaggccgtggag caggtgaagaatgcctttaataagctccaagagaaaggcatctacaaagccatgagtgag tttgatatcttcatcaactacatagaagcctacatgacaatgaagatacaaaactga

DBGET integrated database retrieval system