Symphalangus syndactylus (siamang): 129471864 Help Entry 129471864         CDS       T10134                                  Symbol NPPA Name (RefSeq) natriuretic peptides A   KO K12334   natriuretic peptide A Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn04022   cGMP-PKG signaling pathway ssyn04024   cAMP signaling pathway ssyn04066   HIF-1 signaling pathway ssyn04081   Hormone signaling ssyn04270   Vascular smooth muscle contraction ssyn04714   Thermogenesis ssyn04921   Oxytocin signaling pathway ssyn04923   Regulation of lipolysis in adipocytes ssyn04924   Renin secretion ssyn04925   Aldosterone synthesis and secretion ssyn05143   African trypanosomiasis Brite KEGG Orthology (KO) [BR:ssyn00001]  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     129471864 (NPPA)    04024 cAMP signaling pathway     129471864 (NPPA)    04022 cGMP-PKG signaling pathway     129471864 (NPPA)   09133 Signaling molecules and interaction    04081 Hormone signaling     129471864 (NPPA)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     129471864 (NPPA)    04921 Oxytocin signaling pathway     129471864 (NPPA)    04924 Renin secretion     129471864 (NPPA)    04925 Aldosterone synthesis and secretion     129471864 (NPPA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     129471864 (NPPA)   09159 Environmental adaptation    04714 Thermogenesis     129471864 (NPPA)  09160 Human Diseases   09174 Infectious disease: parasitic    05143 African trypanosomiasis     129471864 (NPPA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ssyn04052]     129471864 (NPPA) Cytokines and neuropeptides [BR:ssyn04052]  Neuropeptides   Unclassified    129471864 (NPPA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  129471864 NCBI-ProteinID:  XP_055116893 LinkDB All DBs Position 22:25048882..25050962 Genome browser AA seq 153 aa AA seqDB search MSSFSTTTVSFLLFLAFQLLGQTRANPVYNAVSNADLMDFKNLLDNLEEKMPLEDEFVPP QMLSEQNEEAGAALSPLPEVPPWTGEVSPVQRDGGALGRGPWDSSDRSALLKSKLRALLT APRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgagctccttctccaccaccactgtgagcttcctcctttttctggcattccagctccta ggtcagaccagagctaatcccgtgtacaatgccgtgtccaacgcagacctgatggatttc aagaatttgctggacaatttggaagaaaagatgcctttagaagatgagtttgtgccccca caaatgctcagtgagcagaatgaagaagcgggggctgctctcagccccctccctgaggtg cctccctggaccggggaagtcagcccagtccagagagatgggggtgccctcgggcggggc ccctgggactcctctgatcgatctgccctcctaaaaagcaagctgagggcgctgctcact gcccctcggagcctgcggagatccagctgcttcgggggcaggatggacaggattggagcc cagagcggactgggctgtaacagcttccggtaccgaagataa

DBGET integrated database retrieval system