Symphalangus syndactylus (siamang): 129473430 Help Entry 129473430         CDS       T10134                                  Symbol TNF Name (RefSeq) tumor necrosis factor isoform X2   KO K03156   tumor necrosis factor superfamily, member 2 Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn01523   Antifolate resistance ssyn04010   MAPK signaling pathway ssyn04060   Cytokine-cytokine receptor interaction ssyn04061   Viral protein interaction with cytokine and cytokine receptor ssyn04064   NF-kappa B signaling pathway ssyn04071   Sphingolipid signaling pathway ssyn04150   mTOR signaling pathway ssyn04210   Apoptosis ssyn04217   Necroptosis ssyn04350   TGF-beta signaling pathway ssyn04380   Osteoclast differentiation ssyn04612   Antigen processing and presentation ssyn04620   Toll-like receptor signaling pathway ssyn04621   NOD-like receptor signaling pathway ssyn04622   RIG-I-like receptor signaling pathway ssyn04625   C-type lectin receptor signaling pathway ssyn04640   Hematopoietic cell lineage ssyn04650   Natural killer cell mediated cytotoxicity ssyn04657   IL-17 signaling pathway ssyn04660   T cell receptor signaling pathway ssyn04664   Fc epsilon RI signaling pathway ssyn04668   TNF signaling pathway ssyn04920   Adipocytokine signaling pathway ssyn04930   Type II diabetes mellitus ssyn04931   Insulin resistance ssyn04932   Non-alcoholic fatty liver disease ssyn04933   AGE-RAGE signaling pathway in diabetic complications ssyn04936   Alcoholic liver disease ssyn04940   Type I diabetes mellitus ssyn05010   Alzheimer disease ssyn05014   Amyotrophic lateral sclerosis ssyn05020   Prion disease ssyn05022   Pathways of neurodegeneration - multiple diseases ssyn05132   Salmonella infection ssyn05133   Pertussis ssyn05134   Legionellosis ssyn05135   Yersinia infection ssyn05140   Leishmaniasis ssyn05142   Chagas disease ssyn05143   African trypanosomiasis ssyn05144   Malaria ssyn05145   Toxoplasmosis ssyn05146   Amoebiasis ssyn05152   Tuberculosis ssyn05160   Hepatitis C ssyn05161   Hepatitis B ssyn05163   Human cytomegalovirus infection ssyn05164   Influenza A ssyn05165   Human papillomavirus infection ssyn05166   Human T-cell leukemia virus 1 infection ssyn05168   Herpes simplex virus 1 infection ssyn05169   Epstein-Barr virus infection ssyn05170   Human immunodeficiency virus 1 infection ssyn05171   Coronavirus disease - COVID-19 ssyn05205   Proteoglycans in cancer ssyn05310   Asthma ssyn05321   Inflammatory bowel disease ssyn05322   Systemic lupus erythematosus ssyn05323   Rheumatoid arthritis ssyn05330   Allograft rejection ssyn05332   Graft-versus-host disease ssyn05410   Hypertrophic cardiomyopathy ssyn05414   Dilated cardiomyopathy ssyn05417   Lipid and atherosclerosis ssyn05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ssyn00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129473430 (TNF)    04350 TGF-beta signaling pathway     129473430 (TNF)    04064 NF-kappa B signaling pathway     129473430 (TNF)    04668 TNF signaling pathway     129473430 (TNF)    04071 Sphingolipid signaling pathway     129473430 (TNF)    04150 mTOR signaling pathway     129473430 (TNF)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129473430 (TNF)    04061 Viral protein interaction with cytokine and cytokine receptor     129473430 (TNF)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     129473430 (TNF)    04217 Necroptosis     129473430 (TNF)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     129473430 (TNF)    04620 Toll-like receptor signaling pathway     129473430 (TNF)    04621 NOD-like receptor signaling pathway     129473430 (TNF)    04622 RIG-I-like receptor signaling pathway     129473430 (TNF)    04625 C-type lectin receptor signaling pathway     129473430 (TNF)    04650 Natural killer cell mediated cytotoxicity     129473430 (TNF)    04612 Antigen processing and presentation     129473430 (TNF)    04660 T cell receptor signaling pathway     129473430 (TNF)    04657 IL-17 signaling pathway     129473430 (TNF)    04664 Fc epsilon RI signaling pathway     129473430 (TNF)   09152 Endocrine system    04920 Adipocytokine signaling pathway     129473430 (TNF)   09158 Development and regeneration    04380 Osteoclast differentiation     129473430 (TNF)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     129473430 (TNF)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     129473430 (TNF)    05170 Human immunodeficiency virus 1 infection     129473430 (TNF)    05161 Hepatitis B     129473430 (TNF)    05160 Hepatitis C     129473430 (TNF)    05171 Coronavirus disease - COVID-19     129473430 (TNF)    05164 Influenza A     129473430 (TNF)    05168 Herpes simplex virus 1 infection     129473430 (TNF)    05163 Human cytomegalovirus infection     129473430 (TNF)    05169 Epstein-Barr virus infection     129473430 (TNF)    05165 Human papillomavirus infection     129473430 (TNF)   09171 Infectious disease: bacterial    05132 Salmonella infection     129473430 (TNF)    05135 Yersinia infection     129473430 (TNF)    05133 Pertussis     129473430 (TNF)    05134 Legionellosis     129473430 (TNF)    05152 Tuberculosis     129473430 (TNF)   09174 Infectious disease: parasitic    05146 Amoebiasis     129473430 (TNF)    05144 Malaria     129473430 (TNF)    05145 Toxoplasmosis     129473430 (TNF)    05140 Leishmaniasis     129473430 (TNF)    05142 Chagas disease     129473430 (TNF)    05143 African trypanosomiasis     129473430 (TNF)   09163 Immune disease    05310 Asthma     129473430 (TNF)    05322 Systemic lupus erythematosus     129473430 (TNF)    05323 Rheumatoid arthritis     129473430 (TNF)    05321 Inflammatory bowel disease     129473430 (TNF)    05330 Allograft rejection     129473430 (TNF)    05332 Graft-versus-host disease     129473430 (TNF)   09164 Neurodegenerative disease    05010 Alzheimer disease     129473430 (TNF)    05014 Amyotrophic lateral sclerosis     129473430 (TNF)    05020 Prion disease     129473430 (TNF)    05022 Pathways of neurodegeneration - multiple diseases     129473430 (TNF)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129473430 (TNF)    05418 Fluid shear stress and atherosclerosis     129473430 (TNF)    05410 Hypertrophic cardiomyopathy     129473430 (TNF)    05414 Dilated cardiomyopathy     129473430 (TNF)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     129473430 (TNF)    04940 Type I diabetes mellitus     129473430 (TNF)    04936 Alcoholic liver disease     129473430 (TNF)    04932 Non-alcoholic fatty liver disease     129473430 (TNF)    04931 Insulin resistance     129473430 (TNF)    04933 AGE-RAGE signaling pathway in diabetic complications     129473430 (TNF)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     129473430 (TNF)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ssyn04052]     129473430 (TNF)    00536 Glycosaminoglycan binding proteins [BR:ssyn00536]     129473430 (TNF) Cytokines and neuropeptides [BR:ssyn04052]  Cytokines   Tumor necrosis fators    129473430 (TNF) Glycosaminoglycan binding proteins [BR:ssyn00536]  Heparan sulfate / Heparin   Cytokines    129473430 (TNF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  129473430 NCBI-ProteinID:  XP_055119887 LinkDB All DBs Position 23:complement(40147802..40150704) Genome browser AA seq 233 aa AA seqDB search MSTESMIRDVELAEEALPKKTGGPQGSRRCFLLSLFSFLLVAGATTLFCLLHFGVIGPQR EEFPNDFSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELT DNQLVVPSEGLYLIYSQVLFKGQGCPPTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRE TPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggacgtggagctggccgaggaggcactccccaagaag acaggggggccccagggctccaggcggtgctttctcctcagcctcttctccttcctgctc gtggcaggcgccaccacgctcttctgcctgctgcactttggagtgatcggcccacagagg gaagagttccccaacgacttctctctaatcagccctctggcccaggcagtcagatcatct tctcgaaccccgagtgacaagcctgtagcccatgttgtagcaaaccctcaagctgagggg cagctccagtggctgaaccgccgggccaatgccctcctggccaatggcgtggagctgaca gataaccagctggtggtgccatcagagggcctgtacctcatctactcccaggtcctcttc aagggccaaggctgcccccccacccatgtgctcctcacccacaccatcagccgcatcgcc gtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccctgccagagggag accccagagggggctgaggccaagccctggtatgagcccatctatctgggaggggtattc cagctggagaagggtgatcgactcagcgctgagatcaatcggcctgactatctcgacttt gccgagtctgggcaggtctacttcgggatcattgccctgtga

DBGET integrated database retrieval system