Symphalangus syndactylus (siamang): 129487765 Help Entry 129487765         CDS       T10134                                  Symbol MAX Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn03083   Polycomb repressive complex ssyn04010   MAPK signaling pathway ssyn05200   Pathways in cancer ssyn05202   Transcriptional misregulation in cancer ssyn05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:ssyn00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     129487765 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129487765 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129487765 (MAX)    05202 Transcriptional misregulation in cancer     129487765 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     129487765 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ssyn03000]     129487765 (MAX)    03036 Chromosome and associated proteins [BR:ssyn03036]     129487765 (MAX) Transcription factors [BR:ssyn03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     129487765 (MAX) Chromosome and associated proteins [BR:ssyn03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      129487765 (MAX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HLH JetA Filament bZIP_2 bHLH_INO4 SlyX bHLH_INO2 SLX9 GAGA_bind DUF7801 DUF4763 XhlA Csm1_N ATG16 Motif Other DBs NCBI-GeneID:  129487765 NCBI-ProteinID:  XP_055145060 LinkDB All DBs Position 8:52080370..52176850 Genome browser AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacggaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcagtcccatcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaaaaccacaca caccagcaagatattgacgacctcaagcggcagaatgctcttctggagcagcaagtccgt gcactggagaaggcgaggtcaagtgcccaactgcagaccaactacccctcctcagacaac agcctctacaccaacgccaagggcagcaccatctctgccttcgatgggggctcggactcc agctcggagtctgagcctgaagagccccaaagcaggaagaagctccggatggaggccagc taa

DBGET integrated database retrieval system