Symphalangus syndactylus (siamang): 129492252 Help Entry 129492252         CDS       T10134                                  Name (RefSeq) C-X-C motif chemokine 2   KO K05505   C-X-C motif chemokine 1/2/3 Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn04060   Cytokine-cytokine receptor interaction ssyn04061   Viral protein interaction with cytokine and cytokine receptor ssyn04062   Chemokine signaling pathway ssyn04064   NF-kappa B signaling pathway ssyn04621   NOD-like receptor signaling pathway ssyn04657   IL-17 signaling pathway ssyn04668   TNF signaling pathway ssyn04936   Alcoholic liver disease ssyn05134   Legionellosis ssyn05146   Amoebiasis ssyn05167   Kaposi sarcoma-associated herpesvirus infection ssyn05323   Rheumatoid arthritis ssyn05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ssyn00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     129492252    04668 TNF signaling pathway     129492252   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129492252    04061 Viral protein interaction with cytokine and cytokine receptor     129492252  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     129492252    04657 IL-17 signaling pathway     129492252    04062 Chemokine signaling pathway     129492252  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     129492252   09171 Infectious disease: bacterial    05134 Legionellosis     129492252   09174 Infectious disease: parasitic    05146 Amoebiasis     129492252   09163 Immune disease    05323 Rheumatoid arthritis     129492252   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129492252   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     129492252  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ssyn04052]     129492252 Cytokines and neuropeptides [BR:ssyn04052]  Cytokines   Chemokines    129492252 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  129492252 NCBI-ProteinID:  XP_055153322 LinkDB All DBs Position 10:64127386..64129595 Genome browser AA seq 107 aa AA seqDB search MARAALSAIPSNPRLLRVALLLLLLVAAGRRAAGAPMATELRCQCLQTLQGIHLKNIQSV NVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcccgcgccgcgctctccgccatccccagcaatccccggctcctgcgggtggcgctg ctgctcctgcttctggtggccgccggccggcgcgcagcaggagcgcccatggccactgaa ctgcgctgccagtgcttgcagaccctgcagggaattcacctcaagaacatccaaagtgtg aacgtgaagtcccctggaccccactgcgcccaaaccgaagtcatagccacactcaagaat gggcagaaagcttgtctcaaccccgcatcccccatggttaagaaaatcatcgaaaagatg ctgaaaaatggcaaatccaactga

DBGET integrated database retrieval system