Symphalangus syndactylus (siamang): 129493362 Help Entry 129493362         CDS       T10134                                  Symbol IL4 Name (RefSeq) interleukin-4 isoform X1   KO K05430   interleukin 4 Organism ssyn  Symphalangus syndactylus (siamang) Pathway ssyn04060   Cytokine-cytokine receptor interaction ssyn04151   PI3K-Akt signaling pathway ssyn04630   JAK-STAT signaling pathway ssyn04640   Hematopoietic cell lineage ssyn04657   IL-17 signaling pathway ssyn04658   Th1 and Th2 cell differentiation ssyn04659   Th17 cell differentiation ssyn04660   T cell receptor signaling pathway ssyn04664   Fc epsilon RI signaling pathway ssyn04672   Intestinal immune network for IgA production ssyn05140   Leishmaniasis ssyn05200   Pathways in cancer ssyn05310   Asthma ssyn05320   Autoimmune thyroid disease ssyn05321   Inflammatory bowel disease ssyn05330   Allograft rejection Brite KEGG Orthology (KO) [BR:ssyn00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     129493362 (IL4)    04151 PI3K-Akt signaling pathway     129493362 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129493362 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     129493362 (IL4)    04660 T cell receptor signaling pathway     129493362 (IL4)    04658 Th1 and Th2 cell differentiation     129493362 (IL4)    04659 Th17 cell differentiation     129493362 (IL4)    04657 IL-17 signaling pathway     129493362 (IL4)    04664 Fc epsilon RI signaling pathway     129493362 (IL4)    04672 Intestinal immune network for IgA production     129493362 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129493362 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     129493362 (IL4)   09163 Immune disease    05310 Asthma     129493362 (IL4)    05320 Autoimmune thyroid disease     129493362 (IL4)    05321 Inflammatory bowel disease     129493362 (IL4)    05330 Allograft rejection     129493362 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ssyn04052]     129493362 (IL4)    00536 Glycosaminoglycan binding proteins [BR:ssyn00536]     129493362 (IL4) Cytokines and neuropeptides [BR:ssyn04052]  Cytokines   Interleukins    129493362 (IL4) Glycosaminoglycan binding proteins [BR:ssyn00536]  Heparan sulfate / Heparin   Cytokines    129493362 (IL4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL4 Mannosyl_trans3 Motif Other DBs NCBI-GeneID:  129493362 NCBI-ProteinID:  XP_055155441 LinkDB All DBs Position 11:119667421..119675955 Genome browser AA seq 153 aa AA seqDB search MGLTSQLLPPLFFLLACAGNFVHGYNCDIALQEIIKTLNSLTEQKTLCTELTVTDIFAAS KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATGRQFHRHKQLIRFLKQLDRNLWGLAGL NSCPVKEANQSTLEDFLERLKTIMREKYSKCSS NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgggtctcacctcccagctgcttccccctctgttcttcctgctagcatgtgccggcaac tttgtccacggatacaactgcgatatcgccttacaggagatcatcaaaactttgaacagc ctcacagagcagaagactctgtgcaccgagttgaccgtaacggacatctttgctgcctcc aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac agccaccatgagaaggacactcgctgcctgggtgcgactggacggcagttccacaggcac aaacagctcatccgattcctgaaacagctcgacaggaacctctggggcctggcaggcttg aattcctgtcctgtgaaggaagccaaccagagtacattggaagacttcttggaaaggcta aagacgatcatgagagagaaatattcaaagtgttcgagctga

DBGET integrated database retrieval system