KEGG   Streptomyces tirandamycinicus: DDW44_23090
Entry
DDW44_23090       CDS       T06843                                 

Definition
(GenBank) penicillin synthase
  KO
K04126  isopenicillin-N synthase [EC:1.21.3.1]
Organism
stir  Streptomyces tirandamycinicus
Pathway
stir00311  Penicillin and cephalosporin biosynthesis
stir01100  Metabolic pathways
stir01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stir00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    DDW44_23090
Enzymes [BR:stir01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.3  With oxygen as acceptor
    1.21.3.1  isopenicillin-N synthase
     DDW44_23090
SSDB
Motif
Pfam: DIOX_N 2OG-FeII_Oxy
Other DBs
NCBI-ProteinID: AWI31341
UniProt: A0A2S1SY79
LinkDB
Position
complement(5221169..5222146)
AA seq 325 aa
MPSADVPTIDISPLFGDDPNEKARVAEAINKACRGSGFFYASNHGIDVKLLQDVVNEFHR
NMTEQEKYDLAINAYNRNNPHVRNGYYMAVKGRKAVESFCYLNPSFDDDHPMIKSGTPMH
EVNIWPDEDRHPRFRPFCEQYYRDMLRLSTVLMRGFALALGKPEDFFDASLAEADTLSSV
SLIRYPYLEDYPPVKTGPDGTKLSFEDHLDVSMITVLYQTQVQNLQVETVDGWQDLPTSE
ENFLVNCGTHMAHITHDYFPAPNHRVKFVNAERLSLPFFLNGGHNSVIEPFVPEGAAGQA
KNEPVSYGDYLQHGLSALIVKNGQT
NT seq 978 nt   +upstreamnt  +downstreamnt
atgccgtcagccgacgtgccgacgatcgacatctcgccgctgttcggtgacgacccgaac
gagaaggcccgcgtcgccgaggcgatcaacaaggcctgccgggggtccggcttcttctac
gcctcgaaccacggcatcgacgtcaagctgctgcaggacgtcgtcaacgagttccaccgg
aacatgaccgagcaggagaagtacgacctcgcgatcaacgcctacaacaggaacaacccg
catgtacgcaacgggtactacatggcggtcaaggggaggaaggcggtcgagtccttctgc
tacctcaacccgtcgttcgacgacgaccacccgatgatcaagtccggaacaccgatgcac
gaagtgaacatctggccggacgaggacaggcatccgcgattccggccgttctgcgagcag
tactaccgggacatgctccggctctccacggtcctcatgcgagggttcgcgctggccctg
gggaagcccgaggacttcttcgacgcctcactcgcggaggccgacacgctgtcctccgtg
tcgctgatccgctacccgtacctcgaggactacccgccggtcaagacgggtccggatggg
acgaagctgagcttcgaggaccacctggatgtgtcgatgatcaccgtgctgtaccagacc
caggtgcagaacctgcaggtcgaaacggtggacgggtggcaggacctgccgacgtccgag
gagaacttcctggtgaactgcggcacccacatggcccacatcacccacgactacttcccg
gctccgaaccaccgcgtgaagttcgtcaacgcggagcggctgtccctgccgttcttcctc
aacggagggcacaacagcgtcatcgagccctttgtgcccgagggcgcggccggccaggcg
aagaacgagccggtctcgtacggcgactacctccagcacggcctcagtgcgctgatcgtc
aagaacggtcagacctga

DBGET integrated database retrieval system