KEGG   Streptococcus troglodytae: SRT_04830
Entry
SRT_04830         CDS       T06912                                 

Name
(GenBank) endonuclease III
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
strg  Streptococcus troglodytae
Pathway
strg03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:strg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SRT_04830
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:strg03400]
    SRT_04830
Enzymes [BR:strg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SRT_04830
DNA repair and recombination proteins [BR:strg03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SRT_04830
 Prokaryotic type
     SRT_04830
SSDB
Motif
Pfam: HhH-GPD HHH DUF4294 DUF3349 Nup54_57_C HHH_5
Other DBs
NCBI-ProteinID: BAQ23744
UniProt: A0A1L7LHQ4
LinkDB
Position
482217..482840
AA seq 207 aa
MVLSKKRARKVLEEIIALYPDAVPSLNFKNHFELLIAVILSAQTTDAAVNKVTPALFAAY
PGPREMAKADLKDLESYISQIGLYRNKAKFLKECSQQLVKHYNGQVPHTRKELETLSGVG
RKTANVVMSIGFGIPAFAVDTHVSRICKHHNIVKSSATPLEVEKRVTEVLPSEEWLPAHQ
ALIYFGREVCHPKNPECQKYPQLYEFD
NT seq 624 nt   +upstreamnt  +downstreamnt
atggttttatcaaaaaaacgtgctcgtaaagtattagaagaaattattgcgctttatcca
gatgctgttcctagcctaaattttaaaaatcattttgagttgttaattgctgttatttta
tcagctcagacaacagatgcagcagttaataaagtgacccctgctttatttgcagcttat
cccggaccaagggaaatggccaaggctgacttaaaagatcttgaatcctatatttctcag
attggactctatcggaataaggcgaaatttttaaaagaatgttcccaacagttagtcaag
cattataatggtcaggtgcctcatacgagaaaagagttagaaactctgtctggtgttggt
cgcaagacagctaatgttgtcatgagtatcggttttggcatccctgcctttgcggtagat
actcatgtcagtcgtatttgcaagcatcataatattgtgaaatcatcggcaaccccttta
gaagtagaaaagcgtgtgacagaggttcttccgtccgaagaatggctgccagctcaccaa
gctttgatttactttggacgggaagtttgccatcccaaaaatcctgaatgtcaaaagtat
ccgcaattgtatgaattcgattga

DBGET integrated database retrieval system