KEGG   Streptococcus troglodytae: SRT_05740
Entry
SRT_05740         CDS       T06912                                 
Symbol
dnlJ
Name
(GenBank) NAD-dependent DNA ligase LigA
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
strg  Streptococcus troglodytae
Pathway
strg03030  DNA replication
strg03410  Base excision repair
strg03420  Nucleotide excision repair
strg03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:strg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SRT_05740 (dnlJ)
   03410 Base excision repair
    SRT_05740 (dnlJ)
   03420 Nucleotide excision repair
    SRT_05740 (dnlJ)
   03430 Mismatch repair
    SRT_05740 (dnlJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:strg03032]
    SRT_05740 (dnlJ)
   03400 DNA repair and recombination proteins [BR:strg03400]
    SRT_05740 (dnlJ)
Enzymes [BR:strg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     SRT_05740 (dnlJ)
DNA replication proteins [BR:strg03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     SRT_05740 (dnlJ)
DNA repair and recombination proteins [BR:strg03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     SRT_05740 (dnlJ)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SRT_05740 (dnlJ)
   MMR (mismatch excision repair)
    DNA ligase
     SRT_05740 (dnlJ)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SRT_05740 (dnlJ)
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 BRCT HHH_5 DNA_ligase_ZBD Nlig-Ia PTCB-BRCT HHH Hydrolase_6 RNA_lig_T4_1
Other DBs
NCBI-ProteinID: BAQ23835
UniProt: A0A1L7LHY8
LinkDB
Position
569272..571230
AA seq 652 aa
MKERMNELVQLLNQYAREYYTKDNPSVSDAEYDKLYRELVELEKEFPEDILPNSPTHRVG
DLVLDGFEKYRHEYPLFSLQDAFSREELEAFDRRIKAEFPQADYLAELKIDGLSISLTYV
DGRLQVGATRGDGTVGENITENLKRVRDIPLHLPENIDLTVRGECYLPKVSFKTINAERR
ENGEAEFANPRNAAAGTLRQLDTKVVAKRKLATFIYQEAGPTAASSQEAVLESFAKLGFT
VNPRHIISSSMDAIWQFIEEVAKERTELAYDIDGVVIKVNSLALQEALGFTVKAPRWAIA
YKFPAEEKSAEILSVDWTVGRTGVVTPTANLTPVQLAGTTVSRATLHNVDYIAEKDIRIG
DTVVVYKAGDIIPAVLHVVESKRDQQMPLPIPTVCPSCQSELIHFEDEVALRCVNPRCPA
QLKEKLIHFASRDAMNIIGLGPAIVEKLFTAELICDVADIYQLTPENLMQLEGIKEKSAT
KLYKAIQASKASSAEKLLFGLGIRHVGSKASRLLMERFESLEQLAAADFDDIAAIDGLGV
VIAESLKTYFATAGAQKLLIELKTAGLNLTYLGKKTASDAILSGITVVLTGKLTNLTRNQ
AKEKLQNLGANVAGSVSKKTSLVIAGSDAGSKLEKAKTLGIEIKDEAWLESL
NT seq 1959 nt   +upstreamnt  +downstreamnt
atgaaagaacgtatgaatgagctggttcagcttcttaatcaatatgccagagaatattat
acaaaagacaatcccagtgtttcagatgctgagtacgataaactctatcgtgaacttgta
gaacttgaaaaagaatttccagaggacattcttcctaatagtccgacgcatcgtgtgggt
gaccttgttttagatggttttgaaaaatatagacatgagtatcctttattttctttacaa
gatgctttttctcgtgaagaattggaagcttttgataggcgtattaaagcggaatttccg
caggctgattatttagcagaattgaaaattgatggtctttccatttctctaacctatgtt
gatggccgtttacaagttggggctaccagaggagacggaacggttggtgaaaatattaca
gagaaccttaagcgtgtgcgagatattccactgcatttacctgaaaatattgatttgaca
gtacgtggggaatgctatttgcctaaagtttcctttaaaactatcaatgctgagcgtagg
gaaaatggtgaggctgaatttgcgaatccgcgaaatgcagcggcaggcaccttgcgtcaa
ttggatactaaggttgtggctaaacgaaaattggcgacttttatctatcaagaggcaggt
ccgacagctgccagcagtcaggaagcagtactagaaagttttgccaagctcggttttaca
gtcaatcctcgtcatattatttcctcatcgatggatgctatttggcagtttattgaagag
gttgctaaggaaagaactgaacttgcctatgatatcgatggcgttgttatcaaagtgaac
agtttggctctacaagaggcgctcggttttacagttaaggcacccagatgggccattgct
tataaatttccagcagaggaaaaatcagcagaaattttgtcggttgactggacagttggt
cgaacaggggttgtgacaccaacagctaatttaacacctgttcagttggcaggaacgacg
gtcagccgggcaaccttgcacaatgttgactacattgctgaaaaggatatccgaattggt
gatacagttgttgtctataaggctggagatattattccggcagttttacatgtcgttgaa
agcaagcgtgaccagcagatgccgctgccaattccaacagtctgtccgtcctgtcagagt
gaactgatccattttgaggatgaggtggctcttcgctgtgttaatccacgctgtccagcc
caattaaaggaaaaattgattcattttgctagtcgtgatgctatgaatattataggatta
ggtccagctattgttgaaaaattatttacagcagaactcatttgcgatgtagctgatatc
tatcagttaactcctgagaaccttatgcagctcgaagggatcaaggaaaaatcagcaact
aagctttataaggctattcaggcttccaaagctagttcagccgaaaaacttttatttgga
ttgggtattcgtcatgtcggcagtaaggcgagcagacttcttatggaacgctttgagagt
cttgagcagttagctgctgctgattttgacgatattgctgctattgatggtttgggagtt
gttattgcagagtccttaaaaacttattttgcaacagcaggtgcacagaaacttttgata
gagttaaaaacagcaggtttgaacttgacttatcttggcaaaaaaacagcaagtgatgcc
attttatctggaataacagttgttctgactggtaaattaacaaatttgacacgtaatcaa
gcaaaggaaaaactgcagaatcttggtgccaatgtagctggaagtgtttctaaaaaaacc
agtttggtcatagcagggagtgatgcaggttctaaattagaaaaagcaaaaactttagga
attgaaattaaagatgaagcttggctagaaagtttgtga

DBGET integrated database retrieval system