Salmo trutta (river trout): 115197730 Help Entry 115197730         CDS       T08542                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism stru  Salmo trutta (river trout) Pathway stru00510   N-Glycan biosynthesis stru00513   Various types of N-glycan biosynthesis stru04141   Protein processing in endoplasmic reticulum Module stru_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:stru00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     115197730    00513 Various types of N-glycan biosynthesis     115197730  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     115197730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  115197730 NCBI-ProteinID:  XP_029615386 Ensembl:  ENSSTUG00000007445 LinkDB All DBs Position 7:58231760..58236771 Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDMYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctggaggctatgaccagatacaccagtccggtgaacccagcagtgttcccccac ctcacggtggtcctactggctatcggcatgttcttcactgcctggttcttcgtctatgag gtgacgtccactaaatacaccagagacatgtacaaagagctgctcatctccctggtggcg tcgctcttcatgggcttcggagtgctgtttctgttactgtgggtcggtatctatgtctga

DBGET integrated database retrieval system