Salmo trutta (river trout): 115199956 Help Entry 115199956         CDS       T08542                                  Name (RefSeq) RING-box protein 1 isoform X1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism stru  Salmo trutta (river trout) Pathway stru03420   Nucleotide excision repair stru04110   Cell cycle stru04114   Oocyte meiosis stru04120   Ubiquitin mediated proteolysis stru04141   Protein processing in endoplasmic reticulum stru04310   Wnt signaling pathway stru04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:stru00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     115199956    04120 Ubiquitin mediated proteolysis     115199956   09124 Replication and repair    03420 Nucleotide excision repair     115199956  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     115199956    04350 TGF-beta signaling pathway     115199956  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     115199956    04114 Oocyte meiosis     115199956  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:stru04121]     115199956    03400 DNA repair and recombination proteins [BR:stru03400]     115199956 Enzymes [BR:stru01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      115199956 Ubiquitin system [BR:stru04121]  Ubiquitin ligases (E3)   UBL E3 ligases    115199956   Multi subunit type E3    SCF complex     Ring finger protein      115199956    Cul2 complex      115199956    Cul3 complex      115199956    Cul4 complex      115199956    Cul7 complex      115199956    Cul8 complex      115199956    Cul9 complex      115199956 DNA repair and recombination proteins [BR:stru03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       115199956     TCR (transcription coupled repair) factors      Cul4-CSA complex       115199956 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  115199956 NCBI-ProteinID:  XP_029618399 Ensembl:  ENSSTUG00000026239 LinkDB All DBs Position 1:complement(53325487..53329389) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSATNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcagcgatggatgttgataccccaagcgccacgaatagtggagcaagtaagaaa cgttttgaagtgaagaagtggaatgcagtggcactttgggcctgggacattgtggtggac aactgtgccatctgtaggaatcacattatggatctctgcatagagtgccaggctaaccag gcctctgccacatcagaggagtgcaccgtagcctggggagtctgcaatcatgcattccat ttccactgtatctcccgttggttgaaaaccaggcaggtgtgccccctagacaacagggag tgggagtttcagaaatatggacactag

DBGET integrated database retrieval system