Salmo trutta (river trout): 115205202 Help Entry 115205202         CDS       T08542                                  Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism stru  Salmo trutta (river trout) Pathway stru03008   Ribosome biogenesis in eukaryotes stru03013   Nucleocytoplasmic transport stru03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:stru00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     115205202    03008 Ribosome biogenesis in eukaryotes     115205202   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     115205202  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:stru03019]     115205202    03009 Ribosome biogenesis [BR:stru03009]     115205202    03016 Transfer RNA biogenesis [BR:stru03016]     115205202    03036 Chromosome and associated proteins [BR:stru03036]     115205202   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:stru04147]     115205202    04031 GTP-binding proteins [BR:stru04031]     115205202 Messenger RNA biogenesis [BR:stru03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      115205202 Ribosome biogenesis [BR:stru03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     115205202   Pre-60S particles     115205202 Transfer RNA biogenesis [BR:stru03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     115205202 Chromosome and associated proteins [BR:stru03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      115205202    Spindle formation proteins     115205202 Exosome [BR:stru04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    115205202 GTP-binding proteins [BR:stru04031]  Small (monomeric) G-proteins   Ran Family    Ran     115205202 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RNA_helicase AAA_24 G-alpha Gtr1_RagA Pox_A32 ArgoMid AAA_7 Septin AAA_16 AAA_22 TsaE DUF5906 SRPRB AAA_33 Motif Other DBs NCBI-GeneID:  115205202 NCBI-ProteinID:  XP_029626790 Ensembl:  ENSSTUG00000030466 UniProt:  A0A674BDN2 LinkDB All DBs Position 13:11784425..11788137 Genome browser AA seq 215 aa AA seqDB search MAEGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGAIKY NVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCG NKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPA LAPPEILMDPSLAAQYEHDLKVASETALPDEDDDL NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggcagagggagagccacaggtccagttcaagcttgtgttggttggcgatggaggaacg ggaaagaccacttttgtcaaaagacatttgacgggagagtttgagaagaaatatgttgcc acgctgggagtggaggtgcacccgctggtcttccacaccaacagaggggccatcaaatac aatgtgtgggacacagccgggcaggagaagtttggagggctccgagatggctactacatc caagcccagtgcgcgatcatcatgtttgacgtcacgtcccgagtcacctacaagaacgta cccaactggcatcgcgatctggtgcgagtctgtgagaacattcccatagtcctctgcggc aacaaggtagacatcaaagacaggaaagtcaaagccaagagcatcgtattccatcgcaag aagaacctccagtactacgacatctctgccaagagtaattacaactttgagaagcccttc ctgtggctagcacggaagctgattggagaccccaacctggagttcgtggccatgcccgct ctcgccccaccagagatcctcatggacccctccctcgcagcgcagtacgagcatgacctc aaagttgcatcagaaacagcgctcccagatgaagatgatgacctttaa

DBGET integrated database retrieval system